KEGG   Strongylocentrotus purpuratus (purple sea urchin): 582454
Entry
582454            CDS       T01019                                 

Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00230  Purine metabolism
spu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    582454
Enzymes [BR:spu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     582454
SSDB
Motif
Pfam: Guanylate_cyc AC_N Mer2 HNOBA
Other DBs
NCBI-GeneID: 582454
NCBI-ProteinID: XP_030843903
LinkDB
Position
Unknown
AA seq 1087 aa
MGLLKKRSSSGSTQPMVRSVSPDIELSTVMDTELVAKAYGKRDTEGKKPRTRRYNPFHRA
FDSSDMETSYQKFFVRRRLETLPVMIAFSFFFDVVVLIIYYLDRAIPSRVIAISIMAICA
VTNLILFSLSRYRLISDWSLTRVMPYLIWSLVCAQSFVDLGLYYQPLMPSDGAGWQVFFI
FASFTMLPVPLGAMILLSTFAITVHCLMVGLLSLANKEYMAEQIGANILLYLCAIILGCV
CYLVSDKQHRMAFLETNESLKTKLTIQEQAAQQEGLLLSVLPKHVADAMVMDVGKKNTGQ
FNRIYIRRHENVSILFADIVGFTAMSGKMTAQELVKTLNALFANFDKLAEKNNQLRIKIL
GDCYYCICGVPEQRIDHAVCSVQMGLDMVVAIAAVRKSTQSGVDMRVGIHTGAVLAGVMG
QKRWQFDVWSTDVVLANNMESGGVPGRVHISQTTFDCLNGEFDVEPGEGDTRSDSIKQAG
IKTYLIKIVKNQNKPLSTGGLDLNGHLDSVEDTDGPAMESVPENFDKIKKDEMEKENQFK
DKNKTVSFEPEVEEREEQKDENQKLDEAIAERESNTKLGEKMYFLLLRFKDKAMESRFQQ
GKDRMSAAGISSALVVVFFVFLVQLLMLPRTAISIATFCVCFVVLSIITYVSLAPSFKKS
YPSILIKLATFVERTPWARIMCATFIIALVSVTDIADVLTCVDESSDNVTNLSPRDLRCL
NPHYFNYMLLLVMAVITTMFQITHIVKFLLTIIITAFYCILMNVIKPILYNRPDDFLEDS
MPSTDHNEVASRIANTVQLVVVAAALIYFNSHLEVTSRLLFYWKTEAKEQKEEVGRMRVK
NENLVLNIMPEHVAKHFLGSKKSEEELYAQSYTESGVMFASMPNFSDFYSEDAINNQGTE
CLRFLNEIISDFDDLLNEPRFKSILKIKTINSTYMAASGVFPNPEEIHYRDDMERWQHLA
DLVDLAFSMRNTLDTINAQSFNNFMLKIGINHGPILAGVIGATKPHYDIWGNTVNVSSRM
ESTGQPGKIQVVEACMNILKRYGFKFEKRGLVKVKGKGELMTYYLIGKDETVRNDMDNSI
PNMVVAS
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtcttctaaagaaacgctcgagcagcggctcgacacagccgatggtgaggagcgtc
tcacccgacatcgagctcagcaccgtgatggacacggagcttgttgctaaggcgtacggc
aagcgtgacacggaagggaagaaaccacgaacccgacgatacaaccccttccaccgcgcc
tttgattctagtgacatggaaacatcgtatcagaaattcttcgtccgccgtcgcctggag
acgctccccgtcatgatcgccttctctttcttcttcgacgtcgtcgtattaatcatctac
tatcttgatcgcgcaatccctagccgcgtcatcgctatctccatcatggcgatctgtgcc
gtcaccaacttgattctgttctccttatcgcgctatcgcctcatctcggactggtcgctt
acgcgcgtcatgccataccttatatggagtctggtatgcgcgcagtccttcgtggacttg
ggtctatattatcagccgctgatgccgagtgatggggctggctggcaagtgtttttcata
tttgcctctttcaccatgttacctgtgcctttaggagccatgatcctcctcagtactttt
gccatcaccgtacattgcctcatggtcgggttgctctccttggctaacaaagaatacatg
gctgaacagatcggagcaaacatcttattgtatttgtgtgccatcatcttgggttgtgtg
tgttaccttgtatccgataagcagcatcgtatggctttcctggagaccaacgagtccctc
aagaccaagctcaccatccaggaacaggccgcacaacaggagggactgttgctctctgta
cttcccaagcatgttgctgatgccatggtgatggatgttgggaagaaaaatactggtcag
ttcaatcgcatctacattagacggcacgaaaatgtcagtattctctttgcggacattgtt
ggttttacggccatgtcgggcaagatgaccgctcaggagttggtcaagacactcaatgcc
ctttttgccaactttgataaactagccgagaagaacaaccagctgcgtatcaaaatcctg
ggtgactgttactattgtatctgtggggtacctgaacagcggatagatcacgccgtctgc
agcgtccaaatgggtctcgacatggtggtcgccattgccgctgttcggaagagtacccaa
tcaggtgtggacatgcgagtaggtatccacactggtgccgtgctggccggggtgatggga
cagaaacgatggcagtttgatgtgtggagtacagacgttgtgttggccaacaacatggaa
tccggcggtgtacctggtcgtgttcacatatcacagaccacgttcgactgtctgaatgga
gagtttgacgtagagcctggtgaaggagacacaaggagtgacagcatcaaacaagcggga
atcaaaacatatctgatcaaaatcgttaaaaaccaaaataagcctttgagtacgggagga
ctagatctgaatggtcacctggattcagtggaagacacagatggtcctgcaatggaaagt
gtgcctgaaaactttgataagatcaagaaagacgagatggaaaaggaaaaccagttcaag
gataagaacaaaacagtttcttttgaaccggaagtagaggagcgggaggaacaaaaggat
gaaaaccagaaacttgatgaagcaattgcagagagggaaagcaatacgaaactcggtgag
aagatgtacttcttgttactgcgtttcaaggataaagcaatggaatctcgtttccaacaa
ggaaaagatcggatgagcgctgccggtatatctagtgccctcgtcgttgtattctttgta
ttcttagtacaacttctaatgttaccaagaactgcaataagcatcgcaactttctgtgtg
tgtttcgtcgttctctccatcataacctatgtctctcttgcaccgagcttcaagaaaagc
tatccatccattctcatcaaattggcaacgtttgttgagcgcacgccatgggcaaggatc
atgtgcgcaaccttcatcattgccttggtgtctgtaacggatattgcagacgtgttgaca
tgcgttgatgagtcatctgataatgtcaccaatctcagtccaagagatcttcgttgtttg
aatccacactacttcaattatatgctactacttgtcatggctgtaataaccaccatgttc
cagatcactcacattgttaagtttctcctcaccatcatcattactgcattctattgcatc
ctcatgaatgtcatcaaacccatcctctacaaccgccctgatgacttccttgaggatagc
atgccatccacagatcacaatgaagtagctagtcggatagctaacaccgtccagcttgtt
gttgtcgcagctgctctcatctattttaattctcaccttgaggtaacgtcacggctgctg
ttttactggaagacagaagcgaaagaacagaaggaagaggtggggagaatgcgagtcaag
aacgagaacttggtcctgaacatcatgcctgagcatgtggctaaacatttcttaggcagt
aagaagagtgaggaggaactgtatgctcagagctacacagagtctggtgttatgttcgca
tctatgccaaacttttctgacttctactccgaggatgcaatcaacaaccagggcactgaa
tgccttcgattcctcaacgaaatcatcagtgatttcgatgatcttctcaatgagccacgg
ttcaagtccattctcaagatcaagaccatcaacagtacttacatggcagcatctggagtg
tttcctaacccggaagagattcactaccgtgatgacatggagagatggcagcatctagct
gacctggtcgatctagccttctcaatgcgcaatacactggataccatcaacgcacagagc
tttaataacttcatgctcaaaataggtatcaaccacgggcctatcctagctggagtgatc
ggggcaaccaaacctcactatgatatctggggaaatactgtcaatgtatcgagtaggatg
gagagtacgggacaaccaggaaaaattcaggttgtggaagcatgtatgaacattctgaag
agatacggcttcaaatttgaaaagcgtggactcgtaaaggtcaaaggtaaaggtgaactg
atgacgtattacttgatagggaaagacgaaacagtcaggaatgatatggacaattccatt
ccaaatatggtggttgcctcttaa

DBGET integrated database retrieval system