KEGG   Strongylocentrotus purpuratus (purple sea urchin): 587557Help
Entry
587557            CDS       T01019                                 

Definition
(RefSeq) 3-ketoacyl-CoA thiolase A, peroxisomal
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00071  Fatty acid degradation
spu00280  Valine, leucine and isoleucine degradation
spu00592  alpha-Linolenic acid metabolism
spu01040  Biosynthesis of unsaturated fatty acids
spu01100  Metabolic pathways
spu01212  Fatty acid metabolism
spu04146  Peroxisome
Module
spu_M00087  beta-Oxidation
spu_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    587557
   00592 alpha-Linolenic acid metabolism
    587557
   01040 Biosynthesis of unsaturated fatty acids
    587557
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    587557
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    587557
Enzymes [BR:spu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     587557
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 587557
NCBI-ProteinID: XP_030845967
LinkDB All DBs
Position
Unknown
AA seq 451 aa AA seqDB search
MSHSQEPSMHRMNALLGHLSRGIQHGSPAAGTAARLHNCTPTLAAAGGTVQRRAVAERKK
NTDDVVVVSALRTPIGKARKGSFKDTRPDDLLAAAFKGVLDETKISPDRLGDIVVGNVLL
PGGGAIHARFAQFYSGIPESVPINTVNRQCSSGLQAFMNAAGGIKSGVYDVAMASGVESM
SRSPMYQGEDLNPKVMLDQTTKDCLIPMGITSENVAEKFGVTRQQQDQMALESQLKAAAA
QTKGYFDREIIPVTTVIIDEAGQERPITVTKDDGVRGNTTIEGLAKLKPAFSPEGTTTAG
NSSQVSDGAAAVLVASRQAAESLNLPVMGVLVSYAVVGVPPSLMGIGPAYAIPEALKKAG
LTVDDVEIFEINEAFASQATYCVQKLGIPMEKVNPNGGAIALGHPLGCTGARQIGTLLHE
LDRRGNRAYGVVSMCIGTGMGAAAVFYYPGK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcattcacaagagcccagtatgcatcgaatgaatgctttgttaggccatctttcc
cggggaattcagcatgggagccctgctgcagggactgctgcaagactgcacaactgtacg
ccgacactggccgcggcaggcggcacggttcagcggcgggcggtagcagagaggaagaaa
aatacagacgatgtggtggttgtgtcagcgctgagaacgcccatcgggaaagccagaaag
ggttcatttaaggacacccgccctgacgatttactggctgcggctttcaagggggtgctg
gatgagaccaagatctccccggacaggctgggagacattgttgtcgggaatgtgctgtta
ccagggggaggggctattcatgccaggttcgctcagttctacagtggtatcccagagtca
gtaccaatcaacacagtaaacagacaatgttcttcaggtcttcaagcctttatgaacgca
gcaggaggcatcaagagtggcgtttatgacgtggcaatggctagcggagttgagtccatg
tcccgttcgccgatgtaccaaggcgaagacctcaaccctaaagtcatgcttgatcagacc
accaaagattgcctgattcccatggggataacgtcagaaaatgttgctgagaaatttggt
gtgacaagacagcaacaagaccagatggccttagagtctcaactcaaagcagcagctgca
cagacaaaaggttattttgaccgagagatcattcccgttaccaccgtgatcatcgatgag
gctgggcaagaaagacctatcacagtgaccaaggatgatggtgtccgtggtaacacgacc
atagagggccttgctaaactcaaaccagcattttccccagaaggcactaccacagcaggt
aattccagtcaagtgagtgacggagcagcagcagtgctggtagccagtcgacaggctgcc
gagtctctcaacctccctgtcatgggtgtcctagtatcctacgccgtggtgggtgtccca
ccctccctcatgggcatcggaccggcctacgccatcccagaggcccttaagaaggcgggc
ttgacggttgatgacgttgaaatctttgagatcaatgaagcttttgcaagtcaggcgaca
tactgcgtacagaagctgggcattcctatggagaaggtgaaccctaatgggggcgctata
gcactgggtcatccactcggctgcacaggggcacgacagatcggtacgcttcttcacgag
ctggaccgcaggggtaacagggcctatggtgtagtctccatgtgtatcggtactggaatg
ggtgctgcagcagttttctactacccaggcaaatag

DBGET integrated database retrieval system