KEGG   Strongylocentrotus purpuratus (purple sea urchin): 589006
Entry
589006            CDS       T01019                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:spu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    589006
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spu03000]
    589006
Transcription factors [BR:spu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    589006
SSDB
Motif
Pfam: bZIP_1 bZIP_2 Shugoshin_N HALZ UPF0242 HAP1_N
Other DBs
NCBI-GeneID: 589006
NCBI-ProteinID: XP_011666987
LinkDB
Position
Unknown
AA seq 710 aa
MALQFMSNTDDKFLEDNLLSSEDWGDPGFYNGNHVRDLSEDLNVAEEMAFNSGLDEEDAL
SRSSDLLSSITSGDLSGDLSVDLTKTWLGMTDEEHHADTTSFTIKNEPLSPPPSSDSSDS
SSESSQASQTLQNGNQAHVHIKLESPPLTPLRDSSTDSPSPPIGGQHTFFTIANGNLPNK
VTKSLASGVINGAKKGVAIAPKPTNGAIKLPLAPKLEPVATKTSIHSPTKPTVTIKQIPA
AVRPTIIVKQSSPSPLATGRGSCAPPLAKQAKIIPVSAHNNIPSPTQPVQVVTQPCPPNV
DVKAWKRQQRMIKNRESACLSRKKKKEYVQELECKAQILEKEIRRLRSENHSLRSKMETL
VKENTTLKKMHSSLLSSPGRTATYLLGIVLIIGFNLSPLSLFNQNGGVASDFQTGSHAGR
ALLSFSESTNENASKLYSQSNPAILRHASIHDIMEDVHLWESIANQSASEVAIATMKEIR
YLLPQGNTSCPHQMNITDTIRLTDVLQFWAKKQTVEQKKSKKVEELRKKKKKKKRGQPQY
RRFRSGPALHVESDERALQLYDHFFQRTYDNLLEALNRRDDTFYVVSFSNDHLLLPATTH
NNTHRPKMSLVMPTVTANESMWNTPKDHISMMQIDCEVVDTKVVHVKNHASTPPPVDDHN
KTTYHRSSVPATPQHSDAATRGPLARAPPSYVATDEIGYHPRNLTAVNTP
NT seq 2133 nt   +upstreamnt  +downstreamnt
atggctttgcagtttatgtctaacacagatgataaatttctggaagataatcttctgtcg
tccgaggattggggggatcctgggttctacaatggaaatcatgtacgagatttatcagaa
gatttaaatgttgctgaagaaatggcctttaattctggactggatgaagaggatgctctg
tcaagatctagtgaccttttatccagtattacctcaggtgaccttagtggtgacctcagt
gttgacctgactaaaacctggcttggcatgaccgatgaggaacatcacgcagacactacc
agttttacgattaagaatgagcccctttcacctcctccgtcatcagattcgtcagactcc
tccagtgaatctagccaagcttcgcagactttacagaatggtaaccaagcccatgtccac
atcaagctggaatccccaccccttaccccactccgtgattccagcacagactccccatcc
ccacccattggtgggcagcacactttcttcactatcgccaatggaaacttgccaaacaaa
gtcaccaagtccctcgccagtggggtcatcaatggtgccaagaagggcgtcgccattgcc
cccaagcctaccaatggtgccatcaagttacccctggctccaaagctggaaccggtggct
acaaaaacatccattcactcacctactaagccaacagttactattaaacaaataccagca
gctgtgagaccaacaatcattgtcaaacagagttcgccatcgccgttagcaacagggcgt
ggttcgtgtgcccctccactagccaaacaggccaagattataccggtatccgctcacaac
aacattccatcacccacacaacctgtacaagtagtcactcagccttgccctcctaatgtt
gatgtaaaagcatggaagaggcagcaaagaatgataaaaaatagagagtctgcgtgctta
tcaaggaagaagaaaaaggagtatgtacaagagttggaatgcaaggcacagatcttggag
aaagaaattcggaggttgagatcagaaaaccattcccttagaagtaagatggaaactttg
gtaaaggagaatacaactcttaagaaaatgcattcgtctcttttgtcgtcgcctggtagg
acagctacctatctactaggaatagttctaatcattggattcaacctttctccgttgagc
ctcttcaatcaaaatggcggtgtagcctccgactttcagacgggtagtcatgcgggtcgt
gcgctacttagcttctcagaatcaaccaatgagaatgcctcaaagctctacagccaatca
aatccagccattctcagacacgcctccatacacgacatcatggaagatgttcatctgtgg
gagagcatcgccaaccagtcggcttcagaagttgccatagcaaccatgaaggagattcgc
tatctgctgcctcagggcaacacgtcttgcccccatcagatgaatattacagacaccatc
aggctgacagatgtccttcagttctgggctaaaaaacaaactgtagagcagaagaagtcc
aagaaagtagaagaactacgaaagaagaagaaaaagaaaaagcgcggtcagccccaatac
agacgcttccgttctggtccagcgcttcatgtggagtcagatgagagggcgctacaactc
tatgatcactttttccagaggacgtacgacaatctgctggaggcacttaataggagggat
gatacgttctacgtggtgtctttcagcaatgatcatctgctgttgcctgccaccactcac
aacaacacccacagacctaagatgtctcttgtcatgccaacagtcacagctaatgagtct
atgtggaacacgccgaaggatcacatctccatgatgcagatcgactgtgaggtcgtggat
accaaggtcgtacacgtcaagaaccatgcctccaccccacccccggtcgacgaccacaac
aagaccacttaccaccggtcttctgtccccgccaccccccagcatagcgatgcagccacc
aggggacccctagccagagccccacccagctacgtggctactgatgagattgggtatcac
cctcggaacctcacagcagtcaatacaccatag

DBGET integrated database retrieval system