KEGG   Strongylocentrotus purpuratus (purple sea urchin): 589416Help
Entry
589416            CDS       T01019                                 

Definition
(RefSeq) cytosolic beta-glucosidase
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 589416
NCBI-ProteinID: XP_011679255
LinkDB All DBs
Position
Un
AA seq 519 aa AA seqDB search
MARPGMFIALIVVFLTLISSSTTEFVFEDVFNDPERDTFLHGTFPEGFIWGVGTSAYQIE
GAWSEDGKGPNIWDVFTHIPGKTYDNQNGDIACDSYHNFERDVEMMKELGLTHYRFSLSW
SRIFPTGFTHQVNPAGVQYYHRLIDSLLEAGIQPAVTLYHFDHPQMLEELGGWENEMMVP
YFQAYADFCFNEFGDKVKIWLTINEPEVIAIQGYEAGSFAPGKTRPGYGAYRVGHTMLKA
HARAWHTYDQKYRATQGGKISIVFNSFWTEPADPENQADVDAAERMRMFELGNIANPIFG
NGDYPELVKAVVGNMSRAQGLTVSRLPSFTPEEQQLMKGTADFFSLNHYSTRFVAYKKAE
FNPVPTVYDDFQAEFISDPVWPQAASEWLKVVPWGFRRLLNWIKTNYGDVPIYVTENGVS
EQDGPLNLDDEFRTKYYRSYINEALKASKIDGVNLQGYFAWSLLDNFEWEYGVSKRFGLY
HVDFNDPARTRRAKKSALTYTQIIKDNGFPSEEQAKVEL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgccccggcatgttcatcgccctgatcgtcgtattcctaacattgatctcctcg
tcgacgacggagttcgtcttcgaagatgtcttcaatgatccggaacgcgacacctttctc
cacggaaccttccccgagggatttatctggggtgttggtacgtcagcctatcagatagag
ggagcttggagtgaggatggaaaggggccaaatatctgggacgttttcactcacatccct
ggaaagacatatgacaaccagaatggcgacatcgcctgcgatagctatcataactttgaa
cgcgacgtcgaaatgatgaaggagctcggtctgacgcactatcggttctctctctcctgg
tcaagaatattcccgactgggttcactcatcaggtgaatcccgcaggggtgcagtactac
caccgtttgattgattccctcctggaagctggtatccaacccgctgttaccctctatcat
ttcgatcatcctcagatgttagaagaactcggtggatgggaaaatgagatgatggtcccc
tactttcaggcgtatgccgacttttgtttcaatgagttcggcgataaggtgaagatttgg
cttacaatcaacgagcccgaagtgatcgctatccaggggtacgaggcaggctcattcgca
ccgggaaagacgcgcccgggctacggagcctaccgcgtcggacataccatgctcaaggcg
cacgcgcgtgcgtggcacacgtacgatcagaagtaccgcgcaacacagggcgggaaaatt
tctatcgtcttcaactcgttctggacagagccggccgacccagagaatcaggccgatgtt
gatgcggcggagaggatgaggatgtttgaactcggcaacatagcgaatccaatctttgga
aacggagactatccggagctcgtcaaggctgtggtagggaacatgagtcgtgctcaaggt
cttactgtatcccgtttgccttcattcactcctgaagaacagcagctcatgaagggtaca
gccgacttctttagtctcaaccactattcaaccagatttgttgcctacaagaaagctgaa
ttcaaccccgtacctactgtatacgatgatttccaggcggaattcatttccgatccagtc
tggccccaagctgcctctgaatggctgaaggttgttccatggggtttccgtcgtcttctg
aattggatcaagactaactatggtgacgtacccatctacgtcacagagaacggtgtatct
gagcaagacgggcccctgaacctggatgatgaatttagaaccaagtactaccgatcatat
atcaatgaagctctcaaagcctccaaaattgatggtgtcaacttgcaggggtatttcgct
tggtctttgctcgacaactttgaatgggagtatggagtcagcaaacgcttcggtttgtac
cacgtagatttcaacgatcctgcgcgtactcgacgcgccaaaaaatcggcgctcacctac
acccagatcatcaaggataatggatttccttctgaagaacaggccaaagtagaattgtaa

DBGET integrated database retrieval system