KEGG   Strongylocentrotus purpuratus (purple sea urchin): 590938Help
Entry
590938            CDS       T01019                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00562  Inositol phosphate metabolism
spu01100  Metabolic pathways
spu04068  FoxO signaling pathway
spu04070  Phosphatidylinositol signaling system
spu04140  Autophagy - animal
spu04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    590938
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    590938
   04070 Phosphatidylinositol signaling system
    590938
   04150 mTOR signaling pathway
    590938
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    590938
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:spu01009]
    590938
Enzymes [BR:spu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     590938
    3.1.3.48  protein-tyrosine-phosphatase
     590938
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     590938
Protein phosphatases and associated proteins [BR:spu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    590938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 590938
NCBI-ProteinID: XP_795616
LinkDB All DBs
Position
Un
AA seq 400 aa AA seqDB search
MASKLRNMVSKKKRRFIDKGFDLDLSYIYPNIIAMGFPAESLEGVYRNKLEVVVKFFNEK
HGERYKVYNLCSERNYDTTKFYNRVAHYPFDDHNPPRLELIKPFCEDLDNWLGADGQNVA
AIHCKAGKGRTGVMICAYMLHRRLYQTASEALDFYASKRTKNRKGVTIPSQRRYVEYYGN
LIVRELEYKPTTLLLTRIDLETVPMFNGGSCAPAFVIYQQKVKIFSSQPYEVAKKERSVR
CEFPLPVPICGDIKIEFFNKPNKLKKDRMFHFWFNTFFVANSNLLNSSSQQDLANNGSSD
NSSHCSEDNMEALDADCTVLRLQKDQLDRANKDKTNKWYSPNFKVICYFKRVENEKPRRP
SGDSNDRSSGTSSDHEHSDGGDISETDSESEWDVTEITHV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaaagttgcgcaatatggtgagcaagaagaagagaagattcatcgataaaggc
ttcgacttggacctgagctacatctatccaaacattatagccatgggtttccctgccgag
tcgctagaaggggtctacaggaacaaactggaagttgtggtcaaatttttcaatgagaag
catggagaaaggtacaaggtgtataacttgtgtagcgagaggaactatgacaccaccaag
ttctacaaccgagttgcacattatccttttgatgatcacaaccctcccagattagaactg
atcaaaccgttttgtgaagatctagacaactggctcggggcggacggtcagaacgtggcg
gcaatacactgtaaagccggcaagggacggacgggtgtaatgatctgtgcatacatgtta
cacagaaggttgtaccagacggcaagtgaggcattagatttctatgcatccaaacggaca
aagaacagaaagggagtgacgatcccatcacaacggcggtacgttgaatactatggcaat
ctgatagtcagggaactggagtacaagcccacgactcttcttctgactcgcatcgatctc
gagacggtgcccatgttcaacgggggctcctgcgctcccgccttcgtcatctatcaacaa
aaggtcaagatcttctcatcgcaaccatatgaggtggcaaaaaaagagaggagcgtgagg
tgtgaattcccgctccctgtgcctatctgcggcgacatcaaaatagagttctttaacaag
ccaaataaactcaaaaaggatcggatgtttcacttctggttcaacaccttctttgtggcc
aactccaaccttctcaactcaagtagccagcaagatcttgccaacaacggatcatcagac
aactcatcgcattgcagcgaagacaacatggaggctctggacgcagactgcaccgtcctc
aggttacagaaggaccagttagatagagcaaacaaagataagacgaacaagtggtattcc
cccaatttcaaggttatctgctacttcaaacgggtcgagaacgagaagccaaggagaccg
tcgggggacagcaatgaccgatcatcgggtacgagtagtgatcatgaacacagtgatgga
ggtgacatatcagagacagactcggaatccgaatgggatgtgacggagatcactcatgta
tga

DBGET integrated database retrieval system