KEGG   Strongylocentrotus purpuratus (purple sea urchin): 593501Help
Entry
593501            CDS       T01019                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
Enzymes [BR:spu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     593501
Peptidases [BR:spu01002]
 Metallo Peptidases
  Family M2
   593501
Exosome [BR:spu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   593501
CD molecules [BR:spu04090]
 Proteins
  593501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 593501
NCBI-ProteinID: XP_011664148
LinkDB All DBs
Position
Un
AA seq 1319 aa AA seqDB search
MAEWKMITTLVAMVCAFVPMSYAYDVIDLTTIREMEAMFTDKLPRLACSDPSSDTCEYFN
QTGKIRDPDLGKYWLDHCVNTAYVEVRYTNCLAVWNYETNITKENTEEMHRIQGVSGGLH
ATISRQTKMLDPTHLDERSQRIISFMNQGTYFSTTEDAFKEREVQDNMTTIFATGKVCRK
REHAQRKKRSEQCLNMEPGLQHLMSESRDYDELLWAWKAWHDAVGPKIGKLYPTYRCCGY
EDRGDLLRRRYEDPHFVEEIDDLWDAVKPMYLQIHAFVRRKLGEKYGTDKVNPTGPIPAH
LLGNMWAQKWGQIFDLVTPYPGHGTVDVTEEMQKQNWTVSKMFHAANNFFTSLGWRSMPN
AFWEKSMLERPRGRQVECHGSASDFYKNREVRIKMCTEITMEDLYTAHHEMGHCQYFLHY
RHQQYEFREGANPGFHEAVGDTIALSVDTPSYLHQLGLLADDKVDEELQINYLMRVALDK
ISFLPFGLLIDKWRWKVFSGEIQPEDYNTAWWNMRRHYQGIESPIERTPTDFDPGAKYHI
ASGTPYIRYFVSFIIQFQFQKKLCEESKSTEPLHLCNIYNSKEAGQKFGSMLEMGASKPW
QDAMEALTGQRRMDASAIIEYFQPLVKWLTEENEKNNEKIGWDYCPLSVSFHVDTIIHLV
EEELIMMEFTRKIVFFGLIAMFSTSITMSMTMDESENDQESEGSNYNETQFEIFLEEMNQ
RAMVEYQNSIEKSWNYNSNITEYNKQQMIDNSLRLANFSKEMRDLALVFNATDFTDTNQR
HFRKAVFIGNAALKNKSEIQEGATLVARMKGRFSTGQACKEDGTCYNLQPGLTRIMGYSR
NYSELFWAWDAWRDAVGPANRQDFARYVVLKNKVAVANEEPNAAAYWQSSYEDEGFPRVA
EELYQQIKPLFEQLHAYVRRKLYQVYGPKYIXLKGLSPAHLVGNMWAQTWAGLFDLCEPF
PNKTRVDVTQSMVEQNYTVIKMFELADEFFTSLGLIPVPTSLWNESMFERPTDGRKVNCH
ASAWDFYNQVDFRIKMCTEITMGHLLTIHHELGHIQYYMQYKEQHVQFRSGANPAFHEAV
GDVMSLSVSTPRHLHTIGLLDELEEDDEADLNHLMKVALTKIAFLPFGYLMDQWRWSVFE
GTTPSSKYNEDWWKLRLKYQGLIPPNKRTEDDFDPAAKYHISAGVPYIRYFISFLLQFQF
HDALCKAAGHDGPLHRCDIYRSREAGTLLSNMLSKGSSQPWDEALEAVTGTKEINATALM
TYFQPLIEYLSQENLKNGETLGWPEMYTPLDPSVGVGTMFSPTFILVLLPAALWILLHY
NT seq 3960 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtggaagatgattacgacacttgtggctatggtctgcgccttcgtaccgatg
tcgtatgcctatgatgtcatcgatttgacgacgattagagaaatggaagcgatgttcacc
gataagcttcctagattagcatgttctgatccctcgtcggacacatgtgaatactttaac
caaacaggcaagatccgtgatcctgacttgggcaaatactggcttgaccattgcgtgaac
acagcatacgtggaggttcgatacacgaattgcctagctgtctggaactatgagactaat
attaccaaagaaaacacagaagagatgcatcgcatacaaggcgttagtggcggcctacat
gcgactatttctagacaaaccaaaatgttggatccgactcatctagatgagagaagtcaa
agaatcatctcattcatgaaccaaggcacttatttttcaacaactgaagatgcatttaaa
gaacgtgaggtccaggacaacatgacaactatcttcgctaccggaaaggtttgtcggaag
agagagcatgcacagaggaagaaacgatcggagcaatgcttgaacatggaaccaggcctt
caacacctgatgagcgaatcacgtgactatgatgaattgctatgggcgtggaaagcatgg
cacgatgcggtggggccgaagataggcaaactctacccaacctataggtgttgtggttat
gaagatcgtggcgacttactccgtcgtcgttatgaagacccacacttcgtggaggagatc
gacgacctttgggatgcagtcaaaccgatgtacctccagatccatgcctttgtgagaaga
aagctgggagagaagtacgggacggacaaggttaaccccacaggacctatacccgctcat
ctccttggtaacatgtgggctcagaaatggggtcaaatcttcgatttagtgactccctac
cccggccacgggaccgtagatgtcactgaagagatgcagaaacagaattggactgtcagc
aaaatgttccatgctgctaacaattttttcacttctcttggatggaggtcgatgccaaac
gcattctgggagaaatcgatgttggagagaccacgtggccgacaggtagaatgccatgga
tctgcctcggacttttacaagaacagggaagtcaggattaagatgtgcactgagattacg
atggaggacctctacacagcccaccatgagatgggccattgtcaatacttccttcattac
cgacaccagcagtacgagttcagggaaggtgctaatccaggatttcatgaggctgtagga
gacaccattgccctgtcagtggatactcctagctaccttcatcagctaggtcttctagca
gacgacaaggtggacgaggaattgcagatcaactatcttatgagagtggctctagacaag
atatcctttctaccttttggtctcctgattgacaaatggcgttggaaggtgtttagcggt
gagatccagcctgaagattacaatacggcatggtggaacatgagacgacattaccaaggg
atagagagccccatagaacgcacaccaactgatttcgaccccggagcgaaataccatata
gcatcaggaacaccgtatataaggtatttcgtgagcttcatcatccagttccagttccaa
aagaaactttgtgaggaatccaaaagtactgagcccctacatctatgcaacatctacaac
tcaaaggaagccggtcagaaattcggatcaatgctagagatgggcgccagtaaaccttgg
caggatgctatggaggctttgacaggacagagacgtatggatgctagcgccatcattgaa
tacttccaaccactcgtcaaatggcttacagaggaaaacgagaagaataatgaaaagatt
gggtgggattattgcccgctatcggtgtcattccatgtcgacacaataattcacttggtt
gaagaagagctcatcatgatggagttcaccaggaaaatcgtcttcttcggcttgattgct
atgttttcgacgtccattacgatgtcgatgacgatggatgagtctgagaatgaccaggaa
tctgaaggtagtaactacaacgagacgcaatttgaaatcttcctggaggagatgaaccaa
agagcgatggtagagtatcaaaactctatagagaagtcttggaactacaattcgaacatc
acagaatataacaaacagcagatgattgacaatagtctccgcttagccaacttttcgaag
gagatgagagaccttgcccttgtttttaacgctactgacttcacggataccaaccaacgg
cacttcagaaaggctgtcttcattggaaatgccgctctcaaaaacaaatctgagattcaa
gaaggggcaacgttggttgcgagaatgaaaggacgattctccaccggccaggcgtgtaaa
gaggacgggacgtgttacaacctacagccaggtttgacaagaatcatgggatattctaga
aactacagcgagcttttttgggcttgggatgcctggcgtgatgcagttggacccgcaaac
cgccaggattttgctcgttacgtcgtgctgaagaacaaagtagctgttgcaaacgaggaa
ccgaatgctgctgcctactggcaatcatcatacgaagatgagggcttccccagagtagcc
gaggagctctaccagcagataaagccactctttgaacaactccatgcctatgtgaggagg
aagttatatcaagtctatggaccaaagtacatcnatcttaaaggcctatccccagcacac
ttagtaggaaacatgtgggcacagacttgggccggattgttcgatttatgtgagcctttc
ccgaataagacacgagtcgatgttactcagagtatggttgaacagaactacaccgtcatt
aagatgtttgaattagcggatgagtttttcacctctctgggcttaattcccgtaccaaca
tcgctctggaacgaatccatgttcgaacgtcctacagacggcaggaaggttaactgccat
gcctctgcctgggacttctacaaccaagtcgacttcagaatcaagatgtgtacggaaata
acaatgggccacctgctcaccatacatcacgaattaggacacatccagtactacatgcaa
tataaagaacagcacgttcagttccgtagtggagctaacccggcctttcacgaggccgtg
ggcgatgtcatgtccctttcggtctccacacccagacatctccataccatcggtctcctg
gacgaactcgaagaggacgacgaagctgatctgaatcatttgatgaaggttgctctgacc
aaaatagccttcttaccctttggatacctgatggatcagtggagatggagtgtcttcgag
gggaccacaccttcttccaaatacaacgaagactggtggaaactaaggttgaagtatcag
ggccttattccacccaataagcgaactgaagatgattttgatcccgctgctaagtaccac
atatcagctggggttccttacatcaggtacttcatcagtttccttctccagttccagttt
cacgatgctttgtgcaaagcggcgggtcatgatggtccgctacaccgatgtgatatatac
agatctagagaagcagggacactgctctcaaacatgttaagtaaaggttcaagccagcca
tgggatgaggcactagaagcagtcacaggaaccaaggagattaacgcgacagcattgatg
acttactttcaacctttgattgaatacctgagtcaggagaatctaaagaatggcgaaacc
ctaggctggccggagatgtacactcctctcgacccttctgttggagttggaaccatgttc
tcacctacattcatactagtacttttaccagcagctctatggatactacttcactactga

DBGET integrated database retrieval system