KEGG   Strongylocentrotus purpuratus (purple sea urchin): 752989Help
Entry
752989            CDS       T01019                                 

Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu03030  DNA replication
spu03410  Base excision repair
spu03420  Nucleotide excision repair
spu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:spu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    752989
   03410 Base excision repair
    752989
   03420 Nucleotide excision repair
    752989
   03430 Mismatch repair
    752989
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:spu03032]
    752989
   03400 DNA repair and recombination proteins [BR:spu03400]
    752989
Enzymes [BR:spu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     752989
    6.5.1.6  DNA ligase (ATP or NAD+)
     752989
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     752989
DNA replication proteins [BR:spu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    752989
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     752989
DNA repair and recombination proteins [BR:spu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     752989
   NER (nucleotide excision repair)
    Other NER factors
     752989
   MMR (mismatch excision repair)
    Other MMR factors
     752989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 752989
NCBI-ProteinID: XP_030840756
LinkDB All DBs
Position
Unknown
AA seq 715 aa AA seqDB search
MEKKEEEKPMEKKEEEKPMEKKGAKKETKKENEKPVEKKETKKTNAFVWGSSDKKSDVKT
SGTSFRPGSSSYHPVEGACWKKDENVPYMALADTFSIIEETSGRLKTIEILSDFLTSVML
LTPGDLKMCIYLCLNKLAPAYEGLELGIGDTVLMKAIAQATGRSVDKLKVDAAEKGDLGL
VAESSRSTQRTMFTPPRLTIKKVFSKLKDIANLSGNSCMSKKVDLIKGLLVACKNSEARY
LIRSLGGKLRIGLAEQSVLVALGHAGALAKPESDEMILKSKAHTSDSVKKAMDEAALLVK
TAYCEMPTYDALIPALLSHGVTELPNHCRLTPSIPLKPMLAHPTKGVSEVLNRFQDTPFT
CEYKYDGERAQIHLLESGKIHIYSRNQENNTSKYPDIIARLSSSVDEKVKSSILDAEAVA
WDVERKQILPFQVLSTRKRKDADAGDIKVQVCVFAFDLLYLNGESLVRKPLRERRSLLRA
HFKEVEGEFIFAKSMISSDVDDIAVFLEESVKGNCEGLMVKTLDKDATYEIARRSHNWLK
LKKDYLDGVGDTLDVVVLGGFQGRGKRVGSYGGFLLACYDEENEEFQSICKIGTGFKEEE
LEKHTKFFKDHLIEKPRPYYNYDSSVAPDHWFDAVQVWEIKAADLSVSPVHKAAIGIVDP
AKGISLRFPRFIRIRDDKKPEEATGSSQVASMYNNQDQIKNQQANKTSKSEEDFY
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaggaggaagagaaaccgatggagaagaaggaggaagagaaaccgatggag
aagaagggagctaagaaggaaaccaagaaggagaatgagaagccagtggagaagaaggaa
accaagaagactaacgcattcgtgtggggcagcagcgataagaaatctgatgttaagacc
tcggggactagctttagaccaggctcttcatcttatcatccagtggaaggcgcatgctgg
aaaaaagacgagaatgttccatacatggccttagccgacaccttttcaattattgaagaa
acgagtggaagactgaagacgattgagatcttgtcagacttcttgacctctgtgatgctc
ttgacccccggtgaccttaagatgtgtatctacctgtgtctcaataagttagctccagct
tatgaaggattagagctgggtattggtgatacggttctcatgaaggccatcgctcaagca
acaggtcgatcagttgacaagctgaaagttgatgctgctgaaaaaggagatttagggctg
gttgcagagagcagtcgaagcacacagcgtaccatgttcactcctccaaggcttacaatc
aagaaagtcttctcaaaactcaaagatattgctaacttgagtggaaattcatgtatgtca
aagaaggttgatctgatcaaagggctgcttgtagcttgcaagaatagtgaagcaagatat
cttatcagatcacttggagggaagttaaggataggtttagcagagcagtctgttctcgta
gctctagggcatgcaggtgctctagcgaaaccagagtcagatgagatgattctgaagagc
aaggcccatacatcagacagtgtgaagaaagctatggatgaagcagcactgctggtcaag
acagcttactgtgagatgcctacatacgacgccctgattccggcattgttatcccatggt
gtgacggagctacccaaccattgtcgtctgactccatccatccctctcaaacccatgtta
gctcatcctacaaagggcgtatcagaggtactcaacagatttcaagatacacctttcacc
tgtgaatacaagtatgatggtgaacgtgctcagattcatctcttagagtctggtaagatt
cacatatacagcagaaaccaggaaaacaacacctccaaataccctgacattatcgcaagg
ctttcctcttctgttgatgagaaggtaaaatccagtatcttagatgcagaagctgttgct
tgggatgtggagaggaaacagatcttaccgttccaggtattgagtacgaggaagaggaag
gacgctgatgccggtgatatcaaggttcaagtctgtgtctttgcgtttgatcttctctat
ctcaatggagagtccttagtgaggaaacctctgagagagcgcagaagtctgttgagggct
cacttcaaggaagtggaaggagaattcatctttgctaaatccatgatctcgtctgatgta
gatgacattgctgtattcttagaggaatcagttaaaggaaactgtgaaggtctgatggtg
aaaacattggataaggatgccacgtatgagatcgcaagacgctcacacaattggctcaag
ctgaagaaagactacttggatggtgttggagatacattggatgtggttgtgctcggtgga
ttccaagggcgtggtaagagagttggttcctatggaggattcctacttgcctgctatgat
gaagagaatgaagagtttcaatctatttgtaagattggaactggtttcaaggaggaggag
ctggaaaagcacaccaagtttttcaaggatcatttgattgagaagccacgcccatattat
aactatgacagcagtgtagctcctgatcattggtttgatgctgtgcaggtctgggagatc
aaggctgcggatctatctgtctcacccgttcataaagcagccattggaatagtcgatcca
gccaagggtatttccctacgatttcccagattcattcgtatccgtgatgacaagaaacca
gaggaggccacaggctcttcacaggttgccagcatgtataacaaccaggatcaaatcaag
aaccaacaagcaaataaaaccagcaaatcagaagaggatttctactaa

DBGET integrated database retrieval system