KEGG   Strongylocentrotus purpuratus (purple sea urchin): 754063Help
Entry
754063            CDS       T01019                                 

Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00480  Glutathione metabolism
spu00980  Metabolism of xenobiotics by cytochrome P450
spu00982  Drug metabolism - cytochrome P450
spu00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    754063
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    754063
   00982 Drug metabolism - cytochrome P450
    754063
   00983 Drug metabolism - other enzymes
    754063
Enzymes [BR:spu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     754063
Transporters [BR:spu02000]
 Other Transporters
  Pores ion channels [TC:1]
   754063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG HLH
Motif
Other DBs
NCBI-GeneID: 754063
NCBI-ProteinID: XP_001178007
UniProt: W4XWC6
LinkDB All DBs
Position
Un
AA seq 149 aa AA seqDB search
MSNSEEALKYFATYAGLVTVKMMMLGPLTGFYRTRDSAYANEEDFVLTGLKDRRPVFNHP
MIERIRRCSLNDLENIVPFFIIGGLFAVFSGSPLSTILWHYRIFVASRFLHSIAYLIPLP
QPSRALCYFVGIGTNLSMAIRLLMNTWFL
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaactccgaagaagcactgaaatactttgccacctatgcagggctggttaccgtc
aagatgatgatgcttggaccactgactggattctatcggacaagagactcggcatatgcg
aacgaggaggatttcgttctcactggtttgaaagatcgacgaccagttttcaatcacccc
atgatagagcgtatacgaagatgcagcctgaatgaccttgagaatatcgtacccttcttc
atcatcgggggactcttcgccgtcttctctggctctcctctcagcacgatcctctggcat
tatcgtatctttgtcgcttccagattcttacacagcatagcatacctgatacccctgccc
caaccgtccagggctctttgttactttgttggaattggcaccaacctgtccatggccatc
cgacttctgatgaacacctggtttctttaa

DBGET integrated database retrieval system