KEGG   Streptomyces puniciscabiei: BFF78_06690Help
Entry
BFF78_06690       CDS       T05140                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
spun  Streptomyces puniciscabiei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AOR30776
UniProt: A0A1D7Y5F7
LinkDB All DBs
Position
1586407..1587483
Genome map
AA seq 358 aa AA seqDB search
MDLPVMPPVKPMLAKSVARIPPGMHYEAKWDGFRSIAFRDGAEVELGSRTGKPLTRYFPE
LVAALKERVPERCVLDGEIVIAREGHLDFDALTERIHPADSRVRMLAEKTPASFVAFDLL
ALGDESLLGAPLTDRRAQLERALAEATPPVHVAPSTTDLDVAQQWFEQYEGAGLDGVVAK
PLTLRYLQDERAMFKIKHERTADVVVAGYRFHKSGPVVGSLLLGLYDAHGRLQHVGVSAA
FAMKRRAELVEELESLRMDDVAGHPWAAWSDEAAHETARLPGAPSRWSGKKDLSWVPLRP
ERVAEVAYDHMENGQRFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLAEILGEKDRG
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccggtgatgccgcccgtgaagcccatgctcgccaagtccgtggcaaggatc
ccgccgggcatgcactacgaggcgaagtgggacgggttccgctcgatcgcgttccgggac
ggggccgaggtcgagctgggcagccgtaccggaaagccgttgaccaggtactttcccgag
ctggtcgcggcgctgaaggagcgggtgcccgagcggtgcgtgctggacggggagatcgtg
atcgcgcgggagggccatctggacttcgacgcgctgaccgagcggatccatccggccgac
tcccgggtgcggatgctcgcggagaagaccccggcctccttcgtcgccttcgacctgctc
gcgctgggcgacgagtcgctgttgggcgcgcccctgaccgaccgccgggcgcagctggag
cgggcgctcgccgaggcgacgccgccggtgcatgtggcgccctcgacgacggacctcgat
gtggcgcagcagtggttcgagcagtacgagggcgccggactcgacggggtggtcgccaaa
ccgctcaccctgcgctatctgcaggacgagcgggccatgttcaagatcaagcacgagcgg
acggcggatgtggtcgtggccgggtaccgcttccacaagagcggcccggtggtcggctcg
ctgctgctggggctgtacgacgcccacggccggctccagcacgtgggcgtgtcggccgcc
ttcgccatgaagagacgggccgaactggtcgaggaactggagtcactgcgcatggacgac
gtggccgggcatccgtgggcggcctggtcggacgaggccgcccacgagacggcccggctg
ccaggcgcaccgagccgctggtccggcaagaaggacctgtcctgggtgccgctcaggccg
gagcgggtggccgaggtggcctacgaccacatggagaacgggcagcgcttccggcacacc
gcccgcttccgccgctggcgcccggaccgcacaccggagagctgcacctatgcccagctg
gaggagccggtgcgctacgacctggcggagatcctcggcgagaaggaccgcggctga

DBGET integrated database retrieval system