KEGG   Streptomyces puniciscabiei: BFF78_09235Help
Entry
BFF78_09235       CDS       T05140                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
spun  Streptomyces puniciscabiei
Pathway
spun00250  Alanine, aspartate and glutamate metabolism
spun00410  beta-Alanine metabolism
spun00640  Propanoate metabolism
spun00650  Butanoate metabolism
spun01100  Metabolic pathways
spun01120  Microbial metabolism in diverse environments
Module
spun_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:spun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BFF78_09235
   00650 Butanoate metabolism
    BFF78_09235
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BFF78_09235
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BFF78_09235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spun01007]
    BFF78_09235
Enzymes [BR:spun01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     BFF78_09235
Amino acid related enzymes [BR:spun01007]
 Aminotransferase (transaminase)
  Class III
   BFF78_09235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AOR31207
UniProt: A0A1D7Y6F7
LinkDB All DBs
Position
complement(2292346..2293629)
Genome map
AA seq 427 aa AA seqDB search
MNDLYSRHRQVMPDWLALYYDEPIEITHGEGRHVWDSAGNKYLDFFGGILTTMTAHALPE
VTKAVSEQAGRIIHSSTLYLNRPMVELAERIAQVSGIPDARVFFTTSGTEANDTALLLAT
AYRRSNTVLAMRNSYHGRSFSTVGITGNRGWSPTSLSPLQTLYVHGGVRTRGPFAELDDR
AFIDACVADLKDILGHTRPPAALIAEPIQGVGGFTSPPDGLYAAFREVLQEHGILWIADE
VQTGWGRTGEHLWGWQAHAHSGPPDLVTFAKGIGNGTSIGGVIARAEIMNCLDANSISTF
GGTQLTMAAGLANLTYLLEHDLQGNARRVGGLLIERLRAVAAQLPGVREVRGRGLMIGIE
LVKPGTDEADPRAAAAVLEAAREGGLLIGKGGGHNTSALRIAPPLSLTVAEAEEGAAILE
RALRSTY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacctctactcccgccaccgccaggtgatgccggactggctcgcgctctactac
gacgagccgatcgagatcacccacggcgagggccgccacgtctgggactccgccggcaac
aagtacctggacttcttcggcggcatcctgacgacgatgaccgcacacgcactgcccgaa
gtgacgaaggcggtcagcgagcaggccgggcggatcatccactcctcgacgctctacctg
aaccggccgatggtcgaactcgccgagcgcatcgcccaggtgagcggcatcccggacgcc
cgggtcttcttcaccacctccggcaccgaggccaacgacaccgccctgctgctcgccacc
gcctaccgccgcagcaacaccgtcctcgcgatgcgcaacagctaccacggccgctccttc
agcacggtcggcatcaccggcaaccgcggctggtcaccgacctcgctgtccccgctgcag
accctgtacgtccacggcggcgtgcgcacccggggcccgttcgccgagctggacgaccgc
gcgttcatcgacgcctgcgtcgccgacctcaaggacatcctcggccacacccggccgccc
gccgcgctgatcgccgaaccgatccagggcgtcggcggcttcacctccccgcccgacgga
ctctacgccgccttccgcgaggtcctgcaagagcacggcatcctgtggatcgccgacgag
gtgcagaccggctggggccgcaccggcgagcacctctggggctggcaggcgcatgcccac
agcggcccgccggacctcgtcaccttcgccaagggcatcggcaacggcacctcgatcggc
ggggtgatcgcccgcgccgagatcatgaactgccttgacgccaacagcatttcgacgttc
ggcggcacccagctcaccatggccgccggcctggccaatctcacctacctcctcgaacac
gacctccagggcaacgcccgccgggtcggcggcctgctcatcgagcgcctgcgggccgtc
gccgcccagctgcccggcgtgcgcgaggtccgcgggcgcggcctgatgatcggcatcgag
ctggtcaagcccggcaccgacgaggccgatccgcgggcggccgccgccgtgctggaggcg
gcccgcgagggcgggctgctcatcggcaagggcggcggccacaacaccagcgccctgcgc
atcgcccctccgctgtcgctcaccgtcgcggaggccgaggagggcgcggcgatcctggaa
cgggcgctcaggagtacgtactag

DBGET integrated database retrieval system