KEGG   Streptomyces puniciscabiei: BFF78_14075Help
Entry
BFF78_14075       CDS       T05140                                 

Definition
(GenBank) MarR family transcriptional regulator
Organism
spun  Streptomyces puniciscabiei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR_2 MarR HTH_27 Fe_dep_repress TrmB HTH_IclR
Motif
Other DBs
NCBI-ProteinID: AOR32030
UniProt: A0A1D7Y971
LinkDB All DBs
Position
complement(3467666..3468175)
Genome map
AA seq 169 aa AA seqDB search
MPKPLSLPFDPIARADELWKQRWGNVPSMAAITSIMRAQQILLAEVDAVVKPYGLTFARY
EALVLLTFSKAGELPMSKIGERLMVHPTSVTNTVDRLVRSGLVAKRPNPNDGRGTLAVIT
DKGREVVDAATRDLMAMDFGLGVYDAEECAEIFAMLRPLRIAAHDFDEE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgccgaagccactcagcctccccttcgatcccatcgcccgtgccgacgagctctggaag
cagcgctggggaaacgtgccgtccatggccgcgatcacctcgatcatgcgggcccagcag
atcctgctcgccgaggtggacgcggtggtcaagccgtacggactgacgttcgcgcggtac
gaggcactggtgctgctcaccttctccaaggccggtgagctgcccatgtccaagatcggt
gagcggctcatggtgcatcccacctcggtgacgaacaccgtggaccggctggtgaggtcg
gggctggtcgccaagcggcccaatccgaacgatgggcgcggcaccctcgccgtcatcacc
gacaagggacgcgaggtggtcgacgcggccacccgcgacctgatggccatggacttcggg
ctcggggtgtacgacgcggaggagtgcgcggagatcttcgcgatgctgcgcccgctgcgg
atcgcggcgcacgacttcgacgaggagtga

DBGET integrated database retrieval system