KEGG   Streptomyces puniciscabiei: BFF78_14615Help
Entry
BFF78_14615       CDS       T05140                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
spun  Streptomyces puniciscabiei
Brite
KEGG Orthology (KO) [BR:spun00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BFF78_14615
Enzymes [BR:spun01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BFF78_14615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N HSR DUF236
Motif
Other DBs
NCBI-ProteinID: AOR32131
UniProt: A0A1D7Y982
LinkDB All DBs
Position
3580638..3581033
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHYQARATVIKEQ
RAELAKHHVSVLWSDYFKAPHFEKYPELHQLVNDTLKALSAAKASTDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcaaggtcagcgcccactgcgacctgccctgc
ggcgtgtacgacccggcccaggcccgcatcgaggcggagtcggtgaaggccgtccaggag
aagatggccggcaacgacgacccccactaccaggcgcgtgccaccgtcatcaaggagcag
cgcgcggagctcgccaagcaccacgtctccgtgctctggagcgactacttcaaggccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctgaaggccctctcg
gccgccaaggcgtccaccgacccggcgacgggccagaaggcgctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system