KEGG   Streptomyces puniciscabiei: BFF78_19215Help
Entry
BFF78_19215       CDS       T05140                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
spun  Streptomyces puniciscabiei
Pathway
spun00010  Glycolysis / Gluconeogenesis
spun00053  Ascorbate and aldarate metabolism
spun00071  Fatty acid degradation
spun00280  Valine, leucine and isoleucine degradation
spun00310  Lysine degradation
spun00330  Arginine and proline metabolism
spun00340  Histidine metabolism
spun00380  Tryptophan metabolism
spun00410  beta-Alanine metabolism
spun00561  Glycerolipid metabolism
spun00620  Pyruvate metabolism
spun00625  Chloroalkane and chloroalkene degradation
spun00903  Limonene and pinene degradation
spun01100  Metabolic pathways
spun01110  Biosynthesis of secondary metabolites
spun01120  Microbial metabolism in diverse environments
spun01130  Biosynthesis of antibiotics
Module
spun_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:spun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BFF78_19215
   00053 Ascorbate and aldarate metabolism
    BFF78_19215
   00620 Pyruvate metabolism
    BFF78_19215
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BFF78_19215
   00561 Glycerolipid metabolism
    BFF78_19215
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BFF78_19215
   00310 Lysine degradation
    BFF78_19215
   00330 Arginine and proline metabolism
    BFF78_19215
   00340 Histidine metabolism
    BFF78_19215
   00380 Tryptophan metabolism
    BFF78_19215
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BFF78_19215
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BFF78_19215
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BFF78_19215
Enzymes [BR:spun01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BFF78_19215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AOR32911
UniProt: A0A1D7YBE6
LinkDB All DBs
Position
complement(4567436..4568896)
Genome map
AA seq 486 aa AA seqDB search
MSSYFTDLAQQYIGGEWRPGTGSWDVIDFNPYDDEKLASITVATVDEVDQAYRAAARAQK
QWATTNPYARRAVFERALRLIEDREQEIADLIIAELGGTRVKAGFELHLAKEFLRESIHL
ALRPEGKILPSPVDGKENRVYRVPVGVVGVISPFNFPFLLSIKSVAPALALGNAVVLKPH
QNTPIAGGTLIAKIFEEAGLPGGLLNVVVTDIAEIGDAFIEHPVPKVISFTGSDKVGRHV
ATVCAANFKRSVLELGGNSALVVLEDADIDYAVDAAVFSRFVHQGQVCMAANRVLVDASV
AEEFTEKFVAKVRTLKVGDPRDPQTVIGPVINSQQANAISGTVEQAVAEGATALVQGGTS
GNLVEPSVLTGVPADSALLQQEVFGPVVFLIPFDGEEEALRIVNDTPYGLSGAVHTGDIE
RGVAFAKQIDTGMFHVNDGTVHDEPIVPFGGEKHSGLGRLNGETTLESFTTIKWISVQHG
RSGFPF
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcctacttcaccgacctggcccagcagtacatcggcggcgagtggcgtccgggc
accggctcctgggacgtgatcgacttcaacccgtacgacgacgagaagctggcctcgatc
acggtggccacggtcgacgaggtggaccaggcctaccgggccgccgcccgcgcccagaag
cagtgggccacgaccaacccctacgcccgccgcgcggtcttcgagcgggcgctgcgcctc
atagaggaccgcgagcaggagatagccgacctgatcatcgcggaactgggcggcacgcgc
gtgaaggccggtttcgagctgcacctcgccaaggagttcctgcgcgagtcgatccacctg
gcgctgcgccccgagggcaagatcctgccctccccggtcgacggcaaggagaaccgcgtc
taccgggtgccggtgggcgtcgtgggcgtgatcagccccttcaacttccccttcctgctg
tcgatcaagtcggtcgccccggcgctcgcgctcggcaacgccgtggtcctcaagccgcac
cagaacaccccgatcgccggcggcaccctgatcgcgaagatcttcgaggaggccgggctg
cccggcggcctgctcaacgtcgtcgtcaccgacatagccgagatcggcgacgcgttcatc
gagcacccggtcccgaaggtcatctccttcaccggctccgacaaggtcggccggcacgtg
gccaccgtctgcgccgcgaacttcaagcgctcggtgctcgaactgggcggcaacagcgcc
ctggtggtcctggaggacgccgacatcgactacgcggtggacgcggcggtcttcagccgg
ttcgtgcaccagggccaggtctgcatggccgccaaccgggtcctcgtggacgcgtccgtc
gccgaggagttcaccgagaagttcgtcgccaaggtccgcaccctgaaggtcggcgacccg
cgcgacccgcagaccgtcatcggcccggtgatcaactcccagcaggcgaacgccatttcc
ggcaccgtcgagcaggccgtcgccgagggtgccaccgccctcgtccagggcggcacctcc
ggcaacctggtcgagcccagcgtgctcaccggcgtccccgccgactccgcgctgctccag
caggaggtcttcggcccggtcgtcttcctcatcccgttcgacggcgaggaggaggccctc
cgcatcgtcaacgacaccccgtacggcctcagcggcgccgtccacacgggtgacatcgag
cgcggtgtcgccttcgccaagcagatcgacaccggcatgttccacgtgaacgacggcacg
gtccacgacgagccgatcgtgcccttcggcggcgagaagcactccggcctcggccgcctg
aacggcgagacgacgctggagtccttcacgaccatcaagtggatctcggtgcagcacggc
cgcagcggattcccgttctga

DBGET integrated database retrieval system