KEGG   Streptomyces puniciscabiei: BFF78_24675Help
Entry
BFF78_24675       CDS       T05140                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spun  Streptomyces puniciscabiei
Pathway
spun00620  Pyruvate metabolism
spun00680  Methane metabolism
spun01100  Metabolic pathways
spun01120  Microbial metabolism in diverse environments
spun01200  Carbon metabolism
Module
spun_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:spun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BFF78_24675
  09102 Energy metabolism
   00680 Methane metabolism
    BFF78_24675
Enzymes [BR:spun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BFF78_24675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AOR33826
UniProt: A0A1D7YE90
LinkDB All DBs
Position
5749977..5752709
Genome map
AA seq 910 aa AA seqDB search
MSSADDQTTTTSSELRADIRRLGDLLGETLVRQEGPELLDLVEKVRRLTREDGEAAAELL
RGTELETAAKLVRAFSTYFHLANVTEQVHRGRELRARRAAEGGLLSRTADRLKDADPEHL
KQTVQHLNVRPVFTAHPTEAARRSVLNKLRRIAALLETPVQGSDRRRHDVRLAENIDLVW
QTDELRVVRPEPADEARNAIYYLDELHANAVGDVLEDLTAELERVGVRLPDDTRPLTFGT
WIGGDRDGNPNVTPQVTWDVLILQHEHGINDALEMIDELRGLLSNSIRYTGATEELLQSL
NTDLELLPEISPRYKRLNAEEPYRLKATCIRQKLQNTKQRLAQGTPHDPGRDYLGTSELL
HDLRLIQVSLREHRGGLLADGRLARTIRTLAAFGLQLATMDVREHADAHHHALGQLFDRL
GEESWRYADMPREYRAKLLAKELRSRRPLAPTPAPVDAAGQKTLGVFETVKKALKVFGPE
VVESYIISMCQGADDVFAAAVLAREAGLIDLHAGWAKIGIVPLLETTDELRAADTILEDM
LSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRLRLF
HGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLIPSLARENLELTVAAT
LQASALHTAPRQSDEALARWDAAMDVVSDAAHAAYRALVEDPDLPTYFLASTPVDQLADL
HLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVLDEM
HQQWHFFRNFISNVEMTLAKTDLRIAQHYVDTLVPDELKHVFDTIKAEHELTVREVLRVT
GESELLDAQPVLKQTFAIRDAYLDPISYLQVTLLKRQRDAAAAGLSPDPLLSRALLLTVN
GVAAGLRNTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagaccaccacgaccagcagcgagctgcgcgccgacatccgc
cggctgggtgatcttctgggcgagaccctcgtacggcaggagggccccgagctcctcgac
ctggtcgaaaaggtccgccgcctcacccgcgaggacggcgaagccgccgccgagctgctg
cgcggcaccgaactggagaccgcggccaagctggtgcgcgccttctccacctacttccac
ctcgccaacgtcaccgaacaggtgcaccgcggccgcgagctgcgcgcccggcgcgccgcc
gagggcggcctcctctcccgcaccgccgaccggctcaaggacgccgaccccgaacacctc
aagcagaccgtccagcacctgaacgttcgcccggtgttcacggcacaccccaccgaggcc
gcgcgccgctccgtcctgaacaagctccggcgcatcgccgcgctcctggagacccccgtc
cagggctccgaccgccgccgccacgacgtccgcctcgccgagaacatcgacctggtgtgg
cagaccgacgaactgcgcgtcgtacgccccgagcccgccgacgaagcccgcaacgccatc
tactacctcgacgagctgcacgcgaacgccgtcggcgacgtcctggaagacctcaccgcg
gaactggagcgcgtcggcgtcagactccccgacgacacccgccccctcaccttcggcacc
tggatcggcggcgaccgcgacggcaaccccaacgtcaccccccaggtcacctgggacgtc
ctcatcctccagcacgagcacggcatcaacgacgccctggagatgatcgacgagctgcgc
ggactgctctccaactccatccgctacaccggcgccaccgaagagctcctccagtccctg
aacaccgacctcgaactcctccccgagatcagcccccgctacaagcgcctcaacgccgag
gagccctaccggctcaaggccacctgcatccggcagaagctgcagaacaccaagcagcgc
ctcgcccagggcaccccgcacgaccccggccgcgactacctcggcaccagcgagctcctg
cacgacctgaggctcatccaggtctcgctgcgcgaacaccgcggcggcctcctcgccgac
ggccgcctggcccgcaccatccgcaccctggccgccttcggcctccaactcgccaccatg
gacgtccgcgaacacgccgacgcccaccaccacgccctcggccagctcttcgaccgcctc
ggcgaggagtcctggcgctacgccgacatgccccgcgagtaccgcgccaagctcctcgcc
aaggaactgcgctcccgccgtcccctcgcccccaccccggcacccgtcgacgccgccgga
cagaagaccctcggcgtcttcgagaccgtcaagaaggccctgaaggtcttcggccccgaa
gtcgtcgagtcctacatcatctccatgtgccagggcgccgacgacgtcttcgccgccgcc
gtcctcgcccgcgaagccggcctgatcgacctgcacgccggctgggccaagatcggcatc
gtccccctcctggagaccaccgacgaactgcgcgccgccgacaccatcctcgaggacatg
ctctccgacccgtcctaccggcgcctggtcgcgctgcgcggcgacgtccaggaggtcatg
ctcggctactccgactcctccaagttcggcggcatcaccaccagccagtgggagatccac
cgcgcccagcgccgcctgcgcgacgtcgcccaccgctacggcgtccgcctgcgcctcttc
cacggccgcggcggcaccgtcggccgcggcggcggcccctcccacgacgccatcctcgcc
cagccctggggcaccctggaaggcgagatcaaggtcaccgaacagggcgaggtcatctcc
gacaagtacctcatcccctccctcgcccgggagaacctggaactgacggtcgccgccacc
ctgcaggcctccgccctgcacaccgccccccgccagtccgacgaggccctcgcccgctgg
gacgccgccatggacgtggtgtcggacgcggcgcacgcggcctaccgcgccctcgtcgag
gacccggacctgccgacgtacttcctcgcgtcgacgccggtggaccagctcgccgacctg
cacctgggctcccggccctcccgccgccccggctccggcgtctcgctcgacggcctgcgc
gccatcccgtgggtcttcggctggacccagtcccggcagatcgtccccggctggttcggc
gtcggctccggcctcaaggccctgcgcgaggccggcctggacactgtcctcgacgagatg
caccagcagtggcacttcttccgcaacttcatctccaacgtcgagatgaccctcgcgaag
accgacctgcgcatcgcccagcactacgtagacaccctcgtccccgacgagctcaagcac
gtcttcgacaccatcaaggccgaacacgagctgaccgtccgcgaggtcctgcgggtcacc
ggcgagagcgaactcctggacgcccagcccgtcctgaagcagaccttcgccatccgcgac
gcctacctggaccccatctcctacctccaggtcaccctgctcaagcgccagcgcgacgcc
gccgcggccggcctcagccccgacccgctgctctcccgcgccctgctcctcaccgtcaac
ggcgtggcagccggcctgcgcaacaccggctga

DBGET integrated database retrieval system