KEGG   Streptomyces puniciscabiei: BFF78_25595Help
Entry
BFF78_25595       CDS       T05140                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
spun  Streptomyces puniciscabiei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like
Motif
Other DBs
NCBI-ProteinID: AOR33974
UniProt: A0A1D7YEK8
LinkDB All DBs
Position
5976233..5977876
Genome map
AA seq 547 aa AA seqDB search
MRPVGSKYLLEEPLGRGATGTVWRARQRETAGAEAAVAGQPGETVAIKVLKEELASDPDI
VMRFLRERSVLLRLTHPNIVRVRDLVVEGDLLALVMDLVDGPDLHRYLRESGPLTPVAAA
LLTAQIADALAASHADGVVHRDLKPANVLLQQHDGQMHPMLTDFGIARLADSPGLTRTQE
FVGTPAYVAPESAEGRPQTSAVDIYGAGILLYELVTGRPPFAGSTALEVLHQHLSAEPRR
PSTVPDPMWTVIERCLRKNPDERPSAENLARGLRVVAEGIGVHANAAQIAAAEGVGALLV
PDPAPTAVPGAADPTQVLPHGAAGSYDPNAATSVLPHTGGPAGAADPTAVLPNTGAADPT
AVLPNTGPQGQQPEQPHPWQSQLRAARDRNEQTQVQYLAPEDDPLRHRPQRQVARPQQQP
RPAPQARPQQAQPRGRQQGYQQGYGYAPQQQPQRYAPPAPEPQRPVREPRAPRQRSANPM
KIPGLGCLKGCLFTIVILVVASWLIYELTPLHTWIGQGRSYWHEVTHWVGQVSKWMKDLG
GSSGSRN
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
gtgcggccagtcggcagcaagtacctgcttgaggagccgctgggacgcggcgccacaggc
accgtctggcgtgctcgccagcgcgagaccgcgggcgccgaggcggccgtggccgggcag
cccggcgagacggtcgcgatcaaggtcctcaaggaggagctggcgagcgatccggacatc
gtgatgcgcttcctgcgtgagcgctccgtcctgctccggctcacccacccgaacatcgtc
cgggtccgcgacctggtcgtcgagggcgatctgctggcgctggtcatggacctcgtcgac
ggccccgacctgcaccgctatctgcgcgagagcggccccctcaccccggtcgccgccgcg
ctgctgaccgcgcagatcgccgacgcgctcgccgcgagccacgccgacggcgtcgtccac
cgcgacctgaagcccgccaacgtgctgctgcagcagcacgacggccagatgcacccgatg
ctgaccgacttcggcatcgcccgcctcgcggactccccgggcctgacccgcacccaggag
ttcgtcggcacgcccgcgtacgtggcaccggagtccgccgagggccgcccgcagacctcc
gccgtggacatctacggcgccggcatcctgctgtacgagctggtcaccggccgtccgccg
ttcgccggcagcaccgccctggaggtgctgcaccaacacctgagcgccgagccgcgccgc
ccctccaccgtcccggacccgatgtggacggtcatagagcgctgcctgcgcaagaacccc
gacgaacggccgagcgccgagaacctcgcgcgcggcctcagggtcgtcgccgagggcatc
ggcgtgcacgcgaacgccgcgcagatcgccgccgccgagggcgtgggcgcgctgctcgtc
cccgacccggccccgaccgcggtcccgggcgccgccgaccccacgcaggtgctgccgcac
ggcgcggcggggtcgtacgacccgaacgccgcgaccagcgtgctgccgcacaccggcggc
cccgccggcgccgccgaccccaccgccgtactgccgaacacgggcgcggcggacccgacg
gcggtgctgccgaacaccggcccgcaggggcagcagcccgagcagccgcacccctggcag
tcccagttgcgcgccgcccgcgaccgcaacgagcagacgcaggtccagtacctggccccg
gaggacgacccgctgcgccaccggccccagcggcaggtggcccggccccagcagcagccg
cgcccggccccgcaggcccgcccccagcaggcgcagccgcgcggccggcagcaggggtac
cagcagggctacggctatgcgccgcagcagcagccgcagcggtacgcgccgcccgccccg
gagccgcagcggcccgtgcgcgagccccgcgcgccgcgccagcgcagcgccaacccgatg
aagatcccgggactcggctgcctgaagggctgcctgttcacgatcgtcatcctggtcgtg
gccagctggctgatctatgagctgaccccgctgcacacctggatcggccagggccggagc
tactggcacgaggtgacccactgggtcggccaggtgagcaagtggatgaaggatctcggc
ggctcctccggcagccgtaactga

DBGET integrated database retrieval system