KEGG   Streptomyces puniciscabiei: BFF78_30055Help
Entry
BFF78_30055       CDS       T05140                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
spun  Streptomyces puniciscabiei
Pathway
spun00500  Starch and sucrose metabolism
spun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spun00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BFF78_30055
Enzymes [BR:spun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BFF78_30055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: AOR37415
UniProt: A0A1D7YP95
LinkDB All DBs
Position
6995640..6996959
Genome map
AA seq 439 aa AA seqDB search
MNPTTADASPPGTKDVTAVLFEWNYASVAKECTTTLGPAGYGYVQVSPPAEHIQGAQWWT
SYQPVSYKIAGRLGDRTAFKNMIDTCHAAGLRVVVDTVVNHMSAGSGTGTGGSTYSKYDY
PGLYSYPDFDDCTSRVTNYQDRWNVQHCELVGLADLDTGEEYVRKTIAGYMNDLLSLGAD
GFRIDAAKHIPAEDLANIKSRLTNPSVYWKQEVIYGANEAVQPSEYTGNGDVQEFRYAYD
LKRVFNNEKLAYLNNFGEGWGYLGSSVAGVFVDNHDTERNGSTLNYKDGANYTLANVFML
AWPYGAPDINSGYEWSDADAGPPNGGQVNACWQDGWKCQHAWPEIIRMVAFRNATRGQAV
TNWWDDGNNWIAFGRGDKGYVAINHESSSQTRTYQTALPAGTYCNVQNNTTVAVNSSGQF
TATLGSNTALAIYAGKSSC
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgaccaccgccgacgcctccccgcccggcaccaaggacgtcaccgccgtcctc
ttcgaatggaactacgcctcggtggccaaggagtgcaccaccaccctcggccccgccggc
tacggctatgtccaggtctccccgcccgccgagcacatacagggcgcgcagtggtggacg
tcgtaccagccggtgtcgtacaagatcgccggccggctcggcgaccgcaccgccttcaag
aacatgatcgacacctgtcacgcggccggcctgagggtcgtcgtggacaccgtcgtcaac
cacatgtcggcgggcagcggcacgggcaccggcggctcgacgtacagcaagtacgactac
ccgggcctgtactcgtaccccgacttcgacgactgcacctcccgggtcaccaactaccag
gaccgctggaacgtccagcactgcgaactcgtcggcctcgccgacctggacaccggcgag
gagtacgtccgcaagacgatcgccggctacatgaacgacctgctctccctgggcgccgac
ggcttccgcatcgacgcggccaagcacatcccggccgaggacctggcgaacatcaagtcc
cgtctgaccaacccttccgtctactggaagcaggaggtcatctacggcgcgaacgaggcg
gtccagccctccgagtacaccggcaacggggacgtccaggagttccgctacgcctacgac
ctcaagcgcgtcttcaacaacgagaagctggcctacctgaacaacttcggcgagggctgg
ggctacctcggcagctcggtggccggcgtcttcgtcgacaaccacgacaccgagcgcaac
ggctcgaccctcaactacaaggacggcgccaactacaccctggcgaacgtcttcatgctc
gcctggccctacggcgccccggacatcaactccggctacgagtggtccgacgcggacgcc
ggcccgcccaacggaggccaggtcaatgcctgctggcaggacggctggaagtgccagcac
gcctggccggagatcatccgcatggtcgccttccgcaacgcgacgcggggccaggcggtc
accaactggtgggacgacggcaacaactggatcgccttcggccggggcgacaaggggtat
gtggcgatcaaccacgagtcctcgtcgcagacccgcacgtaccagaccgcgctgcccgcc
gggacgtactgcaacgtccagaacaacaccacggtggcggtgaactccagcggacagttc
accgccaccctgggctcgaacacggcgctcgcgatctacgccgggaagtcgagctgctga

DBGET integrated database retrieval system