KEGG   Streptomyces puniciscabiei: BFF78_35035Help
Entry
BFF78_35035       CDS       T05140                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
spun  Streptomyces puniciscabiei
Pathway
spun00071  Fatty acid degradation
spun00280  Valine, leucine and isoleucine degradation
spun00281  Geraniol degradation
spun00362  Benzoate degradation
spun00592  alpha-Linolenic acid metabolism
spun01100  Metabolic pathways
spun01110  Biosynthesis of secondary metabolites
spun01120  Microbial metabolism in diverse environments
spun01130  Biosynthesis of antibiotics
spun01212  Fatty acid metabolism
Module
spun_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:spun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BFF78_35035
   00592 alpha-Linolenic acid metabolism
    BFF78_35035
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BFF78_35035
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    BFF78_35035
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BFF78_35035
   00642 Ethylbenzene degradation
    BFF78_35035
Enzymes [BR:spun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     BFF78_35035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AOR35597
UniProt: A0A1D7YJ27
LinkDB All DBs
Position
8084714..8085883
Genome map
AA seq 389 aa AA seqDB search
MRDAVIVEAVRTPIGKGKPNGSLAHVHPVQLLAHTLRTLVERSGVDPALIDDVIGGTVDQ
VGEQAMNTTRYAVLAAGFPETVPATTVDRQCGSSQQAVHFAAQGVLSGAYDLVIACGVES
MSRVPMWSNVPAGKDPFGPGVAERYPEGLVPQGISAELIAAKWSLTRAQMDEFAVSSHQK
AAAAWRAGLFDAETAPLDGVARDQCVRPDSTPEILGGLKPAYYDPGFAERFPQIEWNVTA
GNASPVNDGASAVLITSSETAARLGLRPLARLHGFAVTGSDPLLMLTGVVPATEKVLHKA
GLRVADIDLFEVNEAFASVVLAWQQETGADPAKVNVHGGAIALGHPLGASGTRLTTTLVH
AMRERGARYALQTMCEAGGLANAMILESV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacgcagtgatcgtcgaagccgtacgcacccccatcggcaagggaaagccgaac
ggctccctcgcccacgtccatcccgtgcagttgctcgcccacaccctgcgcaccctggtc
gagcgctccggcgtcgaccccgcgctgatcgacgacgtcatcggcggcaccgtcgaccag
gtcggcgagcaggccatgaacaccacccggtacgccgtcctcgccgccggcttccccgag
acggtcccggcgaccaccgtggaccgccagtgcggctcctcccagcaggccgtgcacttc
gccgcgcagggcgtcctctccggcgcgtacgacctcgtgatcgcctgcggtgtggagtcg
atgagccgcgtgccgatgtggtccaacgtgcccgcgggcaaggacccgttcggacccggc
gtcgccgagcgctaccccgagggcctggtcccgcagggcatcagcgcggagctgatcgcc
gccaagtggtccctcacccgcgcgcagatggacgagttcgccgtctcctcgcaccagaag
gccgccgcggcatggcgcgccggactcttcgacgccgagaccgcaccactggacggcgtc
gcccgcgaccagtgcgtccgccccgacagcaccccggagatcctcggcggcctcaagccc
gcctactacgaccccggcttcgccgagcgcttcccgcagatcgagtggaacgtcaccgcg
ggcaatgccagccccgtcaacgacggcgcctccgccgtcctgatcacctccagcgagacc
gcggcccgcctcggcctgcgcccgctcgcccgtctgcacggcttcgccgtgaccggctcc
gacccgctgctgatgctcaccggggtcgtcccggcgaccgagaaggtgctgcacaaggcc
gggctgcgggtcgccgacatcgacctcttcgaggtcaacgaagccttcgccagcgtcgta
ctcgcctggcagcaggagaccggcgccgaccccgccaaggtcaatgtgcacggcggggcc
atcgccctcggccacccgctcggcgccagcggcacccggctgaccaccaccctggtccac
gcgatgcgcgaacgcggcgcgcgctacgccctgcagaccatgtgcgaggcgggcggactg
gccaacgcgatgatcctggaaagcgtctga

DBGET integrated database retrieval system