KEGG   Streptomyces puniciscabiei: BFF78_39530Help
Entry
BFF78_39530       CDS       T05140                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
spun  Streptomyces puniciscabiei
Pathway
spun03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:spun00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    BFF78_39530
Enzymes [BR:spun01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BFF78_39530
DNA repair and recombination proteins [BR:spun03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BFF78_39530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AOR37612
UniProt: A0A1D7YQ15
LinkDB All DBs
Position
complement(9108583..9109563)
Genome map
AA seq 326 aa AA seqDB search
MTLPLIAPMLATPGTLPPAAQDERWAYETKQDGQRVMVYLPADGSVLLRARSGQDITAAY
PELRPLGGALGATPAVLDGEVLALDEQGRADFQLLQSRMGLAHAPARAARRAAQVPVHLV
LFDVPYLQESLLRLPYVRRRARLTELGLAGPYWSTPGAVTGHGAQALAATREHGLEGLVC
KRLDSVYEPGVRSRAWIKIRNWRAEDVIVGGWLPGKGRLRGLPGALLVGQRDTQGKLRYV
GGVGTGWSEAERIELARLLDAAASGRCPFDPAPRIPEAHWVLPRLVGEVSYSTRTRAGLL
RQSSWLRLRPDLPPEESAADLPEGFG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctgccgctgatcgcgccgatgctcgccactcccggcacgttgccgcccgccgcc
caggacgagcggtgggcgtacgagaccaaacaggacggccagcgggtgatggtctacctg
cccgctgacggcagcgtgctgctgcgtgcccgctcggggcaggacatcaccgcggcctat
cccgaactgcggccgctcggcggtgcgctcggcgccactccggccgtactggacggcgag
gtgctggccctggacgaacagggccgggccgacttccagttgctgcagagccggatgggc
ctcgcgcacgcccccgcgcgggcggcgcgccgggccgcccaggtgccggtgcatctggtg
ctgttcgacgtgccctacctccaggagtccctgctgcggctgccctacgtacggcggcgg
gcccggctgacggagctgggcctggccgggccgtactggtcgacgccgggcgccgtgacc
gggcacggcgcgcaggcgctcgccgcgacccgggaacacggcttggaaggcctggtgtgc
aaacggctggactcggtgtacgagcccggggtgcgctcccgcgcctggatcaagatccgg
aactggcgtgccgaggacgtgatcgtcggcggctggctgccgggcaaaggacggctgcgc
gggctgcccggagccctgctggtcggtcagcgcgacacgcagggcaagctgcggtacgtc
ggcggagtgggcaccggctggagtgaggcggagcggatcgaactggcccggctgctggac
gccgccgcgagcgggcggtgccccttcgatccggcgccccggatccccgaggcccactgg
gtgctgccccggctggtgggagaggtcagctacagcacccgtacccgggccgggctgctg
cgccagtcgtcgtggctgcggctgcgcccggatctgccgccggaggagtcggcggcggac
ctgcccgagggcttcggctga

DBGET integrated database retrieval system