KEGG   Streptococcus pneumoniae Hungary19A 6 (serotype 19A): SPH_1283Help
Entry
SPH_1283          CDS       T00658                                 

Gene name
ung
Definition
(GenBank) uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
spv  Streptococcus pneumoniae Hungary19A 6 (serotype 19A)
Pathway
spv03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:spv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SPH_1283 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spv03400]
    SPH_1283 (ung)
Enzymes [BR:spv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     SPH_1283 (ung)
DNA repair and recombination proteins [BR:spv03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SPH_1283 (ung)
 Prokaryotic type
     SPH_1283 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ACA36187
UniProt: B1IBW9
LinkDB All DBs
Position
complement(1190896..1191549)
Genome map
AA seq 217 aa AA seqDB search
MEHSSWHALIKAQLPEGYFGKINQFMNQVYVQGTVYPPKEKVFQALLTTPLEEVKVVILG
QDPYHGPGQAQGLSFSVPDSIPAPPSLQNILKELSDDLGVKKSHDLTAWAEQGVLLLNAC
LTVPAGQANGHAGQIWEPFTDAVIQVVNHLDRPVVFVLWGAYARKKKALVTNPHHLIIES
AHPSPLSVYRGFWGSKPFSKANAFLKETGQEPIDWLR
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggaacactcgtcttggcatgctttgattaaggcgcaattacctgaggggtatttcggg
aaaatcaatcagtttatgaatcaggtctatgttcaggggactgtttatccgcccaaagaa
aaggtttttcaggctctcttgacaacaccgcttgaagaagttaaggtggtgattctaggg
caagacccctatcacgggccaggtcaagcgcagggcttgagtttttctgtacctgactct
atcccagctccgccatccttacaaaatatcttgaaagaattgtcagatgatcttggcgtt
aagaaatctcatgatttgacagcttgggctgagcaaggagtcttgcttcttaatgcttgt
ctgacggttcctgctggacaggccaatggtcatgctggtcagatatgggagccctttact
gatgctgtgattcaggtggtcaatcatctagatagaccagtcgtttttgtgctctgggga
gcttatgcacgcaagaagaaggccttggttaccaatcctcaccacttgatcatcgaatca
gcccatcccagtcctttatctgtttacagaggattttggggttccaagcctttttccaag
gccaatgcattcttaaaagagacaggacaagagccaatcgattggcttagataa

DBGET integrated database retrieval system