KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_1964Help
Entry
SPH_1964          CDS       T00658                                 

Definition
(GenBank) type II restriction enzyme DpnII
  KO
K01155  type II restriction enzyme [EC:3.1.21.4]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Brite
Enzymes [BR:spv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.4  type II site-specific deoxyribonuclease
     SPH_1964
Prokaryotic defense system [BR:spv02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   Restriction endonucleases
    SPH_1964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DpnII Fibrinogen_C
Motif
Other DBs
NCBI-ProteinID: ACA36447
UniProt: B1I859
LinkDB All DBs
Position
complement(1825422..1826288)
Genome map
AA seq 288 aa AA seqDB search
MKQTRNFDEWLSTMTDTVADWTYYTDFPKVYKNVSSIKVALNIMNSLIGSKNIQEDFLDL
YQNYPEILKVVPLLIAKRLRDTIIVKDPIKDFYFDFSKRNYSIEEYTMFLEKSGIFDLLQ
NHLVSNLVDYVTGVEVGMDTNGRKNRTGDAMENIVQSYLEAEGYILGENLFKEIEQNEIE
EIFSVDLSAITNDGNTVKRFDFVIKNEQVLYLIEVNFYSGSGSKLNETARSYKMIAEETK
AIPNVEFMWITDGQGWYKAKNNLRETFDILPFLYNINDLEHNILKNLK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaactagaaattttgatgagtggttgtcaacgatgaccgacacagtagctgac
tggacttattatacagattttcctaaggtttataaaaatgtatctagtataaaagttgct
ctaaatattatgaatagtcttattggtagtaaaaatatacaagaggattttttagactta
tatcaaaattatccagaaattttgaaagttgtgcctctacttattgctaaacgtttgaga
gatacgattattgttaaggatccgataaaagatttctattttgattttagtaaacgaaac
tatagtattgaagaatatactatgtttttggaaaaatcaggtatatttgatttattgcaa
aatcatttagtatcaaatttagttgactacgttacaggtgttgaggttggtatggatact
aatgggcgcaaaaatcggactggagatgcgatggaaaatattgttcaaagctatcttgaa
gctgaagggtatattttaggagagaatttatttaaagagattgaacaaaatgaaatagag
gaaattttttctgtcgatttatctgctattacgaatgatgggaatactgtgaaacgtttt
gattttgtcataaaaaatgaacaagtgctttatctgattgaggttaatttttattcagga
agtggttcaaaattaaatgagacggctagatcttacaaaatgattgctgaagaaactaaa
gctattcctaatgttgagtttatgtggattactgatggacaaggttggtataaggctaag
aataatttacgagaaacatttgatattttaccattcttatataatattaacgatttggaa
cataatattttaaagaatttgaaatag

DBGET integrated database retrieval system