KEGG   Streptococcus pneumoniae Hungary19A 6 (serotype 19A): SPH_2136Help
Entry
SPH_2136          CDS       T00658                                 

Definition
(GenBank) aminotransferase, class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
spv  Streptococcus pneumoniae Hungary19A 6 (serotype 19A)
Pathway
spv00220  Arginine biosynthesis
spv00250  Alanine, aspartate and glutamate metabolism
spv00290  Valine, leucine and isoleucine biosynthesis
spv01100  Metabolic pathways
spv01110  Biosynthesis of secondary metabolites
spv01130  Biosynthesis of antibiotics
spv01210  2-Oxocarboxylic acid metabolism
spv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPH_2136
   00290 Valine, leucine and isoleucine biosynthesis
    SPH_2136
   00220 Arginine biosynthesis
    SPH_2136
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spv01007]
    SPH_2136
Enzymes [BR:spv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SPH_2136
    2.6.1.66  valine---pyruvate transaminase
     SPH_2136
Amino acid related enzymes [BR:spv01007]
 Aminotransferase (transaminase)
  Class I
   SPH_2136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 MHC_II_alpha Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ACA37148
UniProt: B1I8U7
LinkDB All DBs
Position
complement(1970003..1971217)
Genome map
AA seq 404 aa AA seqDB search
MKEYNKSSKLEHVAYDIRGPVLEEAMRMRANGEKILRLNTGNPAEFGFTAPDEVIHDLIM
NARDSEGYSDSKGIFSARKAIMQYCQLKKFPNVDIDDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGNAVHYICDEAVEWYPDIDDIKSKITSNTKAIVLINPNNP
TGALYPKEFLLEIIEIARQNDLIIFADEIYDRMVMDGHVHTPVASLAPDVFCVSMNGLSK
SHRIAGFRVGWMVLSGPKTHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGHQSVDELL
LPGGRIYEQRNFIYNAIQDIPGLSAVKPKAGLYIFPKIDRNMYRIDDDEQFVLDFLKQEK
VLLVHGRGFNWQEPDHFRIVYLPRVDELAQIQEKMTRFLKQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatataacaagtctagtaagttagagcatgttgcttatgatatccgtggtcct
gtattggaagaagccatgcggatgcgagcgaatggagaaaagattttacgtctgaataca
ggaaatccagcagaatttggctttacagcgccagacgaggtcattcatgacttgattatg
aatgcgcgtgatagtgaaggctattctgactccaaagggattttctcagcccgtaaggcc
atcatgcagtattgccagctgaagaaattcccaaacgtagatattgatgatatttacctt
ggaaatggtgtcagtgagttgattgtcatgtccatgcaggggcttttggacaatggggat
gaggtcttagtgccaatgccagactatcctctatggacggcggctgtcagcctagctgga
ggaaatgccgttcactatatctgtgatgaagctgttgaatggtacccagatattgacgat
atcaagtcaaaaatcacttccaataccaaggcaatcgtccttatcaatccaaataaccca
actggagccctttatcctaaggaattcttgctggagattattgagattgcccgtcaaaac
gatttgattatctttgcggatgaaatctatgaccgcatggtaatggacggacatgtgcat
acgcctgtggcgagcttggcaccagatgtcttctgtgtcagcatgaatggtctgtcaaaa
tcccaccgcatagcaggtttccgtgtgggttggatggtcttgtctggccctaagactcat
gttaagggctatatcgaagggctcaatatgctgtccaatatgcgcctttgctctaacgtt
ttggcccaacaagtcgtacaaacttccttggggggtcaccaatcagtcgatgaattgctt
cttcctggtggacgaatctacgagcaaagaaatttcatctataatgccattcaagatatt
ccaggtttgtctgccgttaaacccaaggcggggctctatatcttcccaaaaatcgaccgc
aatatgtaccgtatcgatgatgatgagcagtttgtccttgatttcttgaagcaggaaaag
gttctcttggttcatggtcgaggctttaactggcaggaaccagaccacttccgtatcgtt
taccttcctcgtgttgatgagttagcccaaatccaagaaaagatgactcgtttcttgaaa
cagtatcgtagatag

DBGET integrated database retrieval system