KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_1365Help
Entry
SPCG_1365         CDS       T00690                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
spw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spw01100  Metabolic pathways
spw01110  Biosynthesis of secondary metabolites
spw01130  Biosynthesis of antibiotics
spw01230  Biosynthesis of amino acids
Module
spw_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:spw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPCG_1365 (aroB)
Enzymes [BR:spw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     SPCG_1365 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ACB90617
UniProt: B2IQJ3
LinkDB All DBs
Position
complement(1350366..1351433)
Genome map
AA seq 355 aa AA seqDB search
MKIRIDIPHHPYDIQIEKGCMAQAGQWLRELWQPQKVVIVTDNHVASLYAEKVKLSLEDA
GFQVAVFDFLEGEERKNLTTVQKVYEFLVKQGLTRSDGIVALGGGVVGDLAGFVASTYMR
GIHFVQIPTSLTAQVDSSIGGKTGVNTPFAKNMVGTFAQPDGVLIDPLVLETLGKRELIE
GMGEVIKYGLIEDPELWALLTGLNGSVESILEHAETLIEHSCQVKRKMVVEDELDNGIRL
YLNFGHTIGHAIEATAGYGKVMHGEAVAMGMVQISKVAEEKGLMPAGITQSITEMCQKFG
LPVDYENWKVDKLYQALTHDKKARGNTLKLVLVPELGSATIHPVSLEEMKDYLVK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcagaatcgatattcctcatcatccttatgatattcagattgaaaaaggttgt
atggcccaggctggtcagtggttgcgagaactctggcaaccgcaaaaggtagtcattgtg
acagataaccatgtagcctctctctatgcagagaaggtcaagctcagcctagaagatgct
ggttttcaggtagctgtttttgatttcttagaaggtgaagaaagaaagaatttaactact
gttcagaaagtctatgaatttctagtcaagcaaggtctgactcgtagcgatggaatcgtt
gctcttggtggtggcgttgttggggacctggctggctttgtagcctctacctatatgcgg
ggtattcactttgttcagattccgactagtttgacagctcaggttgattcttctatcggt
ggaaagacaggcgttaacacaccatttgctaaaaatatggtggggacctttgcccaacca
gatggggttctgattgatccacttgttcttgaaaccctcggaaaaagagagttgattgaa
gggatgggtgaagttatcaagtatggcttgattgaggatccagaactgtgggctctcttg
acgggactgaatggttctgttgagagtattttggaacatgcagagaccttgattgaacat
tcttgtcaggtgaagcgcaagatggtggttgaagatgagttggacaatggtattcgtctt
tacctcaattttggccacactattggccatgccatcgaagcgactgccggttatggcaag
gtcatgcatggagaggctgttgccatgggaatggtacagatttccaaggttgctgaggaa
aaaggcctcatgccagctggcattacccaatctatcacagagatgtgtcagaaattcggc
ttgcctgttgactatgaaaattggaaagttgacaagctttatcaggctcttactcatgac
aagaaagcgcgtggtaacaccttgaaattggtcttggtgccagagcttggttcagcgacc
attcacccagtttctctggaagagatgaaagactacttggtaaaataa

DBGET integrated database retrieval system