KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_1474Help
Entry
SPCG_1474         CDS       T00690                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Brite
Translation factors [BR:spw03012]
 Eukaryotic Type
  Elongation factors
   SPCG_1474 (tuf)
 Prokaryotic Type
   SPCG_1474 (tuf)
Mitochondrial biogenesis [BR:spw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    SPCG_1474 (tuf)
Exosome [BR:spw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SPCG_1474 (tuf)
  Exosomal proteins of breast cancer cells
   SPCG_1474 (tuf)
  Exosomal proteins of colorectal cancer cells
   SPCG_1474 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase GrpE
Motif
Other DBs
NCBI-ProteinID: ACB90726
UniProt: B2IQV2
LinkDB All DBs
Position
complement(1448401..1449615)
Genome map
AA seq 404 aa AA seqDB search
MEAFTQMAKEKYDRSKPHVNIGTIGHVDHGKTTLTAAITTVLARRLPSSVNQPKDYASID
AAPEERERGITINTAHVEYETEKRHYAHIDAPGHADYVKNMITGAAQMDGAILVVASTDG
PMPQTREHILLSRQVGVKHLIVFMNKVDLVDDEELLELVEMEIRDLLSEYDFPGDDLPVI
QGSALKALEGDSKYEDIVMELMNTVDEYIPEPERDTDKPLLLPVEDVFSITGRGTVASGR
IDRGIVKVNDEIEIVGIKEETQKAVVTGVEMFRKQLDEGLAGDNVGVLLRGVQRDEIERG
QVIAKPGSINPHTKFKGEVYILTKEEGGRHTPFFNNYRPQFYFRTTDVTGSIELPAGTEM
VMPGDNVTIDVELIHPIAVEQGTTFSIREGGRTVGSGMVTEIEA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttggaggcttttactcaaatggcaaaagaaaaatacgatcgtagtaaaccacacgttaac
attggtactatcggacacgttgaccacggtaaaactaccctaactgcagctatcacaact
gttttggcacgtcgcttgccttcatcagttaaccaacctaaagactatgcgtctatcgat
gctgctccagaagaacgcgaacgcggtatcactattaacactgcgcacgttgagtacgaa
actgaaaaacgtcactacgctcacatcgacgctccaggacacgcggactacgttaaaaac
atgatcactggtgctgctcaaatggacggagctatccttgtagtagcttcaactgacgga
ccaatgccacaaactcgtgagcacatccttctttcacgtcaggttggtgttaaacacctt
atcgtcttcatgaacaaagttgacttggttgacgacgaagaattgcttgaattggttgaa
atggaaatccgtgacctattgtcagaatacgacttcccaggtgacgatcttccagttatc
caaggttcagcacttaaagctcttgaaggtgactctaaatacgaagacatcgttatggaa
ttgatgaacacagttgatgagtatatcccagaaccagaacgtgacactgacaaaccattg
cttcttccagtcgaggacgtattctcaatcactggacgtggtacagttgcttcaggacgt
atcgaccgtggtatcgttaaagtcaacgacgaaatcgaaatcgttggtatcaaagaagaa
actcaaaaagcagttgttactggtgttgaaatgttccgtaaacaacttgacgaaggtctt
gctggagataacgtaggtgtccttcttcgtggtgttcaacgtgatgaaatcgaacgtgga
caagttatcgctaaaccaggttcaatcaacccacacactaaattcaaaggtgaagtctac
atccttactaaagaagaaggtggacgtcacactccattcttcaacaactaccgtccacaa
ttctacttccgtactactgacgttacaggttcaatcgaacttccagcaggtactgaaatg
gtaatgcctggtgataacgtgacaatcgacgttgagttgattcacccaatcgccgtagaa
caaggtactacattctctatccgtgagggtggacgtactgttggttcaggtatggttaca
gaaatcgaagcttaa

DBGET integrated database retrieval system