KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_0074
Entry
SPy_0074          CDS       T00050                                 

Gene name
adk
Definition
(GenBank) adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00230  Purine metabolism
spy00730  Thiamine metabolism
spy01100  Metabolic pathways
spy01110  Biosynthesis of secondary metabolites
spy01240  Biosynthesis of cofactors
Module
spy_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SPy_0074 (adk)
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SPy_0074 (adk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spy04147]
    SPy_0074 (adk)
Enzymes [BR:spy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     SPy_0074 (adk)
Exosome [BR:spy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPy_0074 (adk)
SSDB
Motif
Pfam: ADK AAA_17 AAA_33 AAA_18 SRP54 UPF0193 Cytidylate_kin Hydin_ADK Thymidylate_kin
Other DBs
NCBI-ProteinID: AAK33203
UniProt: P69882
LinkDB
Position
75177..75815
AA seq 212 aa
MNLLIMGLPGAGKGTQAAKIVEEFGIAHISTGDMFRAAMANQTEMGRLAKSYIDKGELVP
DEVTNGIVKERLAEDDIAEKGFLLDGYPRTIEQAHALDATLEELGLRLDGVINIKVDPSC
LVERLSGRIINRKTGETFHKVFNPPVDYKEEDYYQREDDKPETVKRRLDVNMAQGEPILE
HYRKLGLVTDIEGNQEITDVFADVEKALLELK
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaatcttttaatcatgggtttgccgggagctggtaaagggacccaagcagctaagatt
gttgaagaatttggtattgctcacatctcaacaggggatatgttccgcgccgcaatggct
aatcaaaccgaaatgggacgtttagctaaaagttatattgataaaggtgaattggttcct
gatgaagtcacaaacgggattgtaaaagagcgcttagctgaggatgatatcgcagaaaaa
ggttttttgcttgatgggtatccacgtactattgaacaagcacacgccttagatgcaaca
cttgaagaactaggactccgcttagatggtgttattaatattaaagtggatccatcatgt
cttgtagagcgtttgagtggtcgtattatcaatcgtaaaactggtgaaacgttccataaa
gtgttcaacccaccagtagattataaagaagaagattactatcaacgtgaagatgataag
cctgaaactgttaaacgtcgtttggacgtcaatatggctcaaggagaacctattcttgaa
cactatcgtaagcttggtcttgttacagatattgaaggtaatcaagaaataacagacgtt
tttgcagatgttgaaaaagcgttgctagaactcaaataa

DBGET integrated database retrieval system