KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_0179
Entry
SPy_0179          CDS       T00050                                 

Gene name
araD
Definition
(GenBank) putative L-ribulose 5-phosphate 4-epimerase
  KO
K03077  L-ribulose-5-phosphate 4-epimerase [EC:5.1.3.4]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00040  Pentose and glucuronate interconversions
spy00053  Ascorbate and aldarate metabolism
spy01100  Metabolic pathways
spy01120  Microbial metabolism in diverse environments
Module
spy_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SPy_0179 (araD)
   00053 Ascorbate and aldarate metabolism
    SPy_0179 (araD)
Enzymes [BR:spy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.4  L-ribulose-5-phosphate 4-epimerase
     SPy_0179 (araD)
SSDB
Motif
Pfam: Aldolase_II
Other DBs
NCBI-ProteinID: AAK33279
UniProt: Q9A1N4
LinkDB
Position
163946..164650
AA seq 234 aa
MAKNLQEMRERVCAANKSLPQHGLVKFTWGNVSEVCRELGRIVIKPSGVDYDLLTPENMV
VTDLDGNVVEGDLNPSSDLPTHVELYKAWPEVGGIVHTHSTEAVGWAQAGRDIPFYGTTH
ADYFYGPVPCARSLTKAEVDGAYEQETGNVILEEFSKRGLDPMAVPGIVVRNHGPFTWGK
TPEQAVYHSVVLEEVARMNRLTEQINPRVEPAPRYIMDKHYLRKHGPNAYYGQK
NT seq 705 nt   +upstreamnt  +downstreamnt
atggcgaaaaacttgcaagaaatgcgtgaacgtgtctgtgcggctaacaagtctctacca
caacacggtcttgtcaaatttacgtggggcaatgtctctgaagtttgtcgtgaattagga
cgtattgtcatcaagccttctggggtggactacgacctcttgacaccagaaaatatggtt
gttacagaccttgatgggaatgtggtcgaaggtgatttgaacccttcttcagatctgcca
acccatgtggaactttataaagcttggccagaagtgggcggtattgtccacactcactcc
acagaagctgttggttgggcacaggcaggtcgtgatattccgttttatgggactacgcat
gctgactacttctatggaccagttccgtgtgctcgttctctcacaaaagcagaagttgat
ggggcttacgagcaagaaactggcaacgtgattttggaagaatttagcaagcgaggctta
gatcctatggcggttccaggaatcgtggttcgcaatcatggcccatttacgtgggggaaa
accccagagcaagccgtttaccactcggttgtcttagaagaagtggctaggatgaatcgc
ttgacagaacaaatcaatccacgcgtagagccagcgccaagatacattatggataagcat
tatttgcgtaaacatggcccaaatgcttattacggtcaaaaatga

DBGET integrated database retrieval system