KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_0447
Entry
SPy_0447          CDS       T00050                                 

Gene name
pfs
Definition
(GenBank) putative MTA/SAH nucleosidase (5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase)
  KO
K01243  adenosylhomocysteine nucleosidase [EC:3.2.2.9]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00270  Cysteine and methionine metabolism
spy01100  Metabolic pathways
spy01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SPy_0447 (pfs)
Enzymes [BR:spy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     SPy_0447 (pfs)
SSDB
Motif
Pfam: PNP_UDP_1
Other DBs
NCBI-ProteinID: AAK33465
UniProt: Q9A160
LinkDB
Structure
PDB: 
4G41

Position
369393..370088
AA seq 231 aa
MKIGIIAAMEEELSLLLANLLDAQEHQVLSKTYYTGRFGKHELILVQSGVGKVMSAMTVA
ILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATAFGYAYGQMAGQPLYYD
CDPQFVAIFKQVLKHEKTNGQVGLIATGDSFVAGQDKIDQIKTAFSDVLAVEMEGAAIAQ
AAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQTLMTFLENLPV
NT seq 696 nt   +upstreamnt  +downstreamnt
atgaaaataggaattattgctgctatggaggaggagttgtccctgctcttagcaaatctt
ttggatgctcaagaacatcaggtgctttcaaaaacttactatacgggtcgttttggcaag
catgagctcattttggtacagtcgggtgttggaaaagtgatgtctgctatgacagttgcg
atcttggttgagcatttcaaagcccaagctattatcaatacaggatcagcaggggcagtc
gcttcacatttagcgatcggagatgtggtggttgcagatcggttagtgtatcatgatgtg
gatgctactgcatttggttatgcttatggtcaaatggctggtcaaccattatactatgat
tgtgatccacagtttgtggctatcttcaaacaagtcctaaaacacgaaaagacaaatggc
caagttggtttgattgcaacaggagacagttttgttgctggtcaggacaagattgaccag
atcaaaacagcttttagcgacgtgttagcagtagaaatggaaggcgcagctattgctcaa
gcagcacatactgcagggaaacccttcatcgttgttcgtgcgatgagtgataccgcagcg
catgatgccaatattacttttgatcaatttattatagaagctggcaagcgttcggcccag
acattaatgacatttttagaaaacttacctgtttaa

DBGET integrated database retrieval system