KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_0608Help
Entry
SPy_0608          CDS       T00050                                 

Gene name
ppc
Definition
(RefSeq) putative phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00620  Pyruvate metabolism
spy00680  Methane metabolism
spy01100  Metabolic pathways
spy01120  Microbial metabolism in diverse environments
spy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:spy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPy_0608 (ppc)
  Energy metabolism
   00680 Methane metabolism
    SPy_0608 (ppc)
Enzymes [BR:spy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SPy_0608 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Asn_synthase
Motif
Other DBs
NCBI-GeneID: 900815
NCBI-ProteinID: NP_268863
UniProt: Q9A0U7
LinkDB All DBs
Position
487638..490400
Genome map
AA seq 920 aa AA seqDB search
MPLKKLESSNNQDIIAEEVALLKEMLENITRRMIGDDAFTVIESIMVLSEKQDYIELEKV
VANISNQEMEVISRYFSILPLLINISEDVDLAYEINYQNNTDTDYLGKLALTIKDLAGKD
NGKDILEQVNVVPVLTAHPTQVQRKTILELTTHIHKLLRKYRDAKAGVINLEKWRQELYR
YIEMIMQTDIIREKKLQVKNEIKNVMQYYDGSLIQAVTKLTTEYKNLAQKHGLELDNPKP
ITMGMWIGGDRDGNPFVTAETLCLSATVQSEVILNYYIDELAALYRTFSLSSTLVQPNSE
VERLASLSQDQSIYRGNEPYRRAFHYIQSRLKQTQIQLTNQPAARMSSSVGLNTSAWSSP
ASLENPILAYDSPVDFKADLKAIEQSLLDNGNSALIEGDLREVMQAVDIFGFFLASIDMR
QDSSVQEACVAELLKGANIVDDYSSLSETEKCDVLLQQLMEEPRTLSSAAVAKSDLLEKE
LAIYTTARELKDKLGEEVIKQHIISHTESVSDMFELAIMLKEVGLVDQQRARVQIVPLFE
TIEDLDNARDIMAAYLSHDIVKSWIATNRNYQEIMLGYSDSNKDGGYLASGWTLYKAQNE
LTAIGEEHGVKITFFHGRGGTVGRGGGPSYDAITSQPFGSIKDRIRLTEQGEIIENKYGN
KDVAYYHLEMLISASINRMVTQMITDPNEIDSFREIMDSIVADSNIIYRKLVFDNPHFYD
YFFEASPIKEVSSLNIGSRPAARKTITEITGLRAIPWVFSWSQNRIMFPGWYGVGSAFKR
YIDRAQGNLERLQHMYQTWPFFHSLLSNVDMVLSKSNMNIAFQYAQLAERQDVRDVFYEI
LDEWQLTKNVILAIQDHDDLLEDNPSLKHSLKSRLPYFNVLNYIQIELIKRWRNNQLDEN
DEKLIHTTINGIATGLRNSG
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
ttgccacttaaaaagttagagagtagtaacaatcaagatatcattgctgaagaagttgct
cttttgaaagaaatgttggaaaatatcacacgacggatgattggagatgatgcgtttaca
gttatcgagtctattatggtgttatctgaaaaacaagattacatagaattagaaaaagtt
gtcgccaatatttcaaatcaagaaatggaagtgatttccaggtatttttctattttaccc
ttgctaatcaatatttcagaagatgtcgatttagcctatgaaatcaattatcaaaataat
acggatactgattatttaggaaaattagccctaaccatcaaggatcttgctggaaaagat
aatggtaaagacattttggagcaggttaatgtggttcctgttttaacagcacatccgacg
caagtacaacgtaaaacgattctggaattgacaactcacattcataaacttctgcgcaaa
taccgtgatgctaaggctggtgtgattaatcttgagaaatggcgtcaggagctatatcgt
tatattgaaatgatcatgcagacagatattattcgcgagaaaaagcttcaggtgaaaaac
gagataaaaaatgtcatgcagtattacgatggttctctcattcaagcagtgaccaagttg
acaacagagtacaaaaacttagcccaaaaacacggtctagagttagacaatcccaaaccc
attaccatggggatgtggattggtggggaccgtgatgggaacccctttgtcacagctgaa
accttgtgcttgtcagctacggttcaaagtgaggttatcctcaattactacattgacgaa
ttagcagccctttaccgaacattttcactgtcgtcaaccttggtacaacccaactcggaa
gtggaacgtttagccagtttgtctcaggaccaatcgatttaccgtggaaatgaaccttat
cgcagagcttttcattatattcaatcgcgtcttaaacaaacacaaattcaactaactaat
cagccagcagctcgtatgagtagtagtgtgggactaaacacatctgcttggtcctcacca
gctagtttagaaaatcccatcttagcctatgactctcctgttgattttaaagctgattta
aaggctattgagcagtcgctacttgataatggcaactccgctttgattgagggggatttg
cgagaagtcatgcaagctgttgatatttttggcttcttcttagcaagcattgacatgagg
caagactccagtgtccaagaagcttgtgtggcagagttattaaaaggagccaatattgtt
gacgattatagctctctttcagaaactgaaaaatgcgatgttctcttacaacaattaatg
gaggagccaaggactttatcctcagcggcagttgctaaatcagacctattggaaaaagaa
ctggctatctatactacggcacgagaattgaaagataagcttggagaagaggttattaaa
caacatattatttcacatacagaaagtgtctctgatatgtttgagttggccatcatgctt
aaagaagtgggattggttgaccagcagcgggctcgtgtgcaaattgttcccctctttgaa
accattgaggatttagataatgcccgtgacatcatggcagcctatttaagccatgacatt
gtcaaatcttggattgcaacgaatcgtaattaccaagaaatcatgttaggttattctgac
agtaataaagatggtggctacttggcatcgggttggactctttataaagctcagaatgaa
ttaacggctattggtgaggaacatggagtgaagatcaccttcttccatggtcgtggagga
acagttggtcgaggaggtggcccttcttatgatgccattacttcacaaccttttggttcc
atcaaagatcggattcgtctgacagagcaaggggaaattattgaaaacaaatacggcaat
aaagatgtggcttattaccatttagaaatgttgatttcagcttctatcaatcgtatggtg
actcaaatgataacagatcctaatgagattgatagttttcgagaaatcatggatagcatt
gttgctgatagcaatatcatttatcgaaaattggtttttgacaatccccatttctatgat
tatttctttgaggcaagtccgattaaggaagtttccagtctcaacattgggtcaagacca
gcggcccgtaaaacgattacggaaattacaggcttgcgtgccattccttgggtcttttca
tggtcacaaaatcgcatcatgtttccaggttggtatggggtaggttcagcctttaaacgt
tatattgaccgagcacaaggtaaccttgaacgcctccaacatatgtatcagacgtggcct
tttttccattccttgttatcaaatgttgatatggtattatctaaatcaaacatgaatatt
gcctttcagtatgcacaactagctgaaaggcaggatgttcgagatgttttttatgagatt
ttggatgagtggcaattgacaaaaaatgttattcttgctatccaagaccatgatgatcta
ttggaggataatccttcccttaagcatagcttgaaatcacgcttgccgtattttaatgtg
ttgaactatattcaaattgaattgattaaacgttggcgtaataatcaacttgacgaaaat
gatgaaaaattgatccatacaactatcaatggcatagcgactggtttacgtaattcaggc
taa

DBGET integrated database retrieval system