KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_0754
Entry
SPy_0754          CDS       T00050                                 

Gene name
atpE
Definition
(GenBank) H+-transporting ATP synthase chain C
  KO
K02110  F-type H+-transporting ATPase subunit c
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00190  Oxidative phosphorylation
spy01100  Metabolic pathways
Module
spy_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPy_0754 (atpE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:spy00194]
    SPy_0754 (atpE)
Photosynthesis proteins [BR:spy00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   SPy_0754 (atpE)
SSDB
Motif
Pfam: ATP-synt_C
Other DBs
NCBI-ProteinID: AAK33697
UniProt: Q9A0J3
LinkDB
Position
614628..614825
AA seq 65 aa
MNPIFALALACFGVSLAEGFLMANLFKAASRQPEIIGQLRSLMILGVAFIEGTFFVTLVM
AFILK
NT seq 198 nt   +upstreamnt  +downstreamnt
atgaatcctattttcgcattggctttggcctgttttggtgtttctcttgctgaaggtttc
ttgatggcaaatcttttcaaagcagcttctcgccaaccagaaatcattggtcaattacgt
tcattaatgatcttgggtgttgcctttatcgaaggtactttcttcgttacccttgttatg
gccttcattcttaaataa

DBGET integrated database retrieval system