KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_0758
Entry
SPy_0758          CDS       T00050                                 

Gene name
atpA
Definition
(GenBank) putative proton-translocating ATPase, alpha subunit
  KO
K02111  F-type H+/Na+-transporting ATPase subunit alpha [EC:7.1.2.2 7.2.2.1]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00190  Oxidative phosphorylation
spy01100  Metabolic pathways
Module
spy_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPy_0758 (atpA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:spy00194]
    SPy_0758 (atpA)
Enzymes [BR:spy01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     SPy_0758 (atpA)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     SPy_0758 (atpA)
Photosynthesis proteins [BR:spy00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   SPy_0758 (atpA)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N Arginosuc_synth
Other DBs
NCBI-ProteinID: AAK33701
UniProt: Q9A0I9
LinkDB
Position
616640..618148
AA seq 502 aa
MAINAQEISALIKKQIENFQPNFDVTETGIVTYIGDGIARARGLDNAMSGELLEFENGAY
GMAQNLESNDVGIIILGDFSAIREGDVVKRTGKIMEVPVGEALIGRVVNPLGQPVDGLGD
IETTGFRPVETPAPGVMQRKSVSEPLQTGLKAIDALVPIGRGQRELIIGDRQTGKTSVAI
DAILNQKGQDMICIYVAIGQKESTVRTQVETLRRYGALDYTIVVTASASQPSPLLFIAPY
AGVAMAEEFMYQGKHVLIVYDDLSKQAVAYRELSLLLRRPPGREAYPGDVFYLHSRLLER
SAKVSDDLGGGSITALPFIETQAGDISAYIATNVISITDGQIFLQENLFNSGIRPAIDAG
SSVSRVGGSAQIKAMKKVAGTLRLDLASYRELEAFTQFGSDLDAATQAKLNRGRRTVEIL
KQPLHKPLPVEKQVVILYALTHGFLDDVPVDDILAFEEALYDYFDVHYNDLFETIRTTKD
LPEEAALDAAIKAFKEHSNFKS
NT seq 1509 nt   +upstreamnt  +downstreamnt
ttggcaattaatgcacaagaaattagcgctttaattaaaaagcaaattgagaacttccag
ccaaatttcgatgtcacagaaactgggatcgttacctatattggtgacggtattgcacgt
gcccgtggattagataatgccatgagtggtgaacttcttgaatttgaaaatggtgcctac
gggatggctcaaaaccttgagtcaaatgatgtgggtattattattcttggtgatttttca
gcaatccgtgaaggagatgtggttaagcgcaccggtaaaatcatggaagtaccagttggt
gaagctctcattggacgtgtggtaaacccacttggacaaccagttgatggcttgggagat
attgaaacaactggctttagaccagtagaaacgccagctcctggtgttatgcagcgtaaa
tccgtttctgaacccttacaaactggattaaaagcaattgatgctttggttccaattggt
cgtgggcaacgtgagttgattatcggagaccgtcaaacaggaaaaacatccgtagctatt
gatgcgattttgaaccaaaaaggtcaagacatgatttgtatctatgtggctattggtcaa
aaagaatcaaccgttcgtacacaagttgaaacccttcgccgttacggtgccttggattat
actattgttgtgacagcgtcagcctcacaaccatcaccattgctctttatcgctccttat
gcgggtgttgccatggctgaagaatttatgtaccaaggcaagcatgtcttgattgtctat
gatgatttatcaaaacaagcggtggcttatcgtgaattgtctctcttgcttcgtcgtcca
ccaggtcgtgaggcttacccaggggatgttttctacttgcatagccgtcttttggaacgc
tctgcaaaagtttctgatgacttaggtggaggttctatcacagctctaccatttatcgaa
acacaggccggagatatctctgcatatattgcgactaacgttatttcgattacagacgga
caaatcttcttgcaagagaacctctttaattcaggaattcgtccagcgattgatgcagga
tcatctgtctcacgtgtaggtggttccgctcaaattaaagcgatgaaaaaggttgctggt
actcttcgtttggatttggcttcctatcgtgaattagaagcctttacccaatttggttcg
gaccttgatgctgcaacacaagcaaaacttaatcgtggtcgccgtacggttgaaatcttg
aagcaaccattgcataaaccgttacctgttgaaaagcaagtcgttattctttatgccctt
actcatggtttcttagatgatgttcctgtagatgatattttggcttttgaagaagctctt
tacgactactttgacgttcattacaatgatttatttgaaactatccgtaccacaaaagac
cttcctgaagaagctgcccttgatgccgctattaaagcgtttaaagaacactcaaacttt
aagtcatag

DBGET integrated database retrieval system