KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1010Help
Entry
SPy_1010          CDS       T00050                                 

Gene name
mutX
Definition
(RefSeq) putative 7,8-dihydro-8-oxoguanine-triphosphatase
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Brite
KEGG Orthology (KO) [BR:spy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spy03400]
    SPy_1010 (mutX)
Enzymes [BR:spy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     SPy_1010 (mutX)
DNA repair and recombination proteins [BR:spy03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    SPy_1010 (mutX)
 Prokaryotic Type
    SPy_1010 (mutX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 901148
NCBI-ProteinID: NP_269187
UniProt: Q99ZZ0
LinkDB All DBs
Position
821197..821673
Genome map
AA seq 158 aa AA seqDB search
MTQLATICYIDNGDSLLLLHRNKKENDVHKGKWISVGGKLEAGETPDECARREILEETHL
TVTEMAFKGIITFPEFTPGHDWYTYVFKVTGFEGDLISDEESREGTLEWVPYDQVLEKPT
WEGDYDIFKWILEDRSFFSAKFTYDQNNQLMDKSVTFY
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgactcaattagcaaccatttgttacattgataatggcgattctttgctattattacac
cgcaataaaaaagaaaatgatgtccacaaaggcaagtggatttcagttgggggtaagctc
gaggctggtgagaccccagatgagtgtgcccgtcgtgagattttagaggaaacccatttg
actgttacagagatggcctttaaaggaatcattacttttccagaatttacccctggtcat
gactggtatacctatgtttttaaagtaacaggatttgaaggagacctcatttcagatgaa
gagtcacgagaaggaaccttggaatgggtaccttacgatcaagtgttggaaaagccaact
tgggaaggtgattatgacatttttaaatggattttagaagaccgttcttttttctctgcc
aaatttacctatgaccaaaacaaccaactcatggataaatctgtgaccttttattga

DBGET integrated database retrieval system