KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1029Help
Entry
SPy_1029          CDS       T00050                                 

Gene name
acoC
Definition
(RefSeq) putative dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00010  Glycolysis / Gluconeogenesis
spy00020  Citrate cycle (TCA cycle)
spy00620  Pyruvate metabolism
spy01100  Metabolic pathways
spy01110  Biosynthesis of secondary metabolites
spy01120  Microbial metabolism in diverse environments
spy01130  Biosynthesis of antibiotics
spy01200  Carbon metabolism
Module
spy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPy_1029 (acoC)
   00020 Citrate cycle (TCA cycle)
    SPy_1029 (acoC)
   00620 Pyruvate metabolism
    SPy_1029 (acoC)
Enzymes [BR:spy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SPy_1029 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 PLA2_B
Motif
Other DBs
NCBI-GeneID: 901162
NCBI-ProteinID: NP_269201
UniProt: Q99ZX6
LinkDB All DBs
Position
836769..838178
Genome map
AA seq 469 aa AA seqDB search
MAFEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDILLEIMSDKTNMELEAEDSGVLLKIT
RQAGDTVPVTEVIGYIGAEGESVDTIASSEKTTEIPVPASADAGPAVAPKENVASPAPQV
AATAIPQGNGGKVRATPAARKAAAEMGIDLGQVPGTGPKGRVHKEDVENFKGAQPKASPL
ARKIAADKGIDLATVSGTGFNGKVMKEDIMAILEAAKPAEAKAPAAKEEKVVDLPEGVEH
KPMSAMRKAISKGMTNSYLTAPTFTLNYDIDMTEMIALRKKLIDPIMAKTGLKVSFTDLI
GMAVVKTLMKPEHEYMNASLINDANDIELHRFVNLGIAVGLDDGLIVPVIHGANKMCLSD
FVLASKDVIKKAQTGKLKAAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPT
PTVVDGEIVSRPIMAMCLTIDHRLVDGMNGAKFMVDLKKLMENPFELLI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaaattattatgccaaagctgggcgttgacatgcaagaaggcgagatcatc
gagtggaaaaaacaagaaggtgataccgtcaatgaaggtgatatccttcttgaaatcatg
tcagacaaaaccaatatggaacttgaggcagaagactcaggtgttcttcttaaaattaca
cgtcaagcaggtgatactgtacctgtaactgaagttatcggttacattggtgcagagggt
gaatcagtagatactattgcttcaagtgaaaaaacaacagaaattccagttcctgcttca
gcagacgctggaccagcagttgctccaaaagaaaatgtggcaagtccagctcctcaagtg
gcagcgacagctattccgcaaggaaatggcggaaaagttcgtgctactccagctgcacgt
aaggcagcagcagaaatgggcattgaccttggccaagttccaggaacaggaccaaaagga
cgtgtccataaagaagacgttgaaaactttaaaggtgctcaaccgaaagcttcaccactt
gctcgtaaaattgcagcagacaaaggtattgatttggcaaccgtatcaggtactggcttt
aacggtaaggtcatgaaagaagacatcatggctattcttgaagcggctaaaccagctgaa
gcaaaagccccagcagctaaagaagaaaaagttgttgatcttccagaaggtgtggaacac
aagccaatgtcagctatgcgtaaggcaatctctaaaggtatgacaaactcttaccttact
gcccctacctttacgcttaactacgatattgacatgacagagatgattgcccttcgtaag
aagttaattgacccaatcatggctaaaacaggccttaaagtcagctttacagacttgatt
ggtatggcagtggttaaaaccttgatgaaacctgagcatgagtacatgaatgcttccctc
atcaatgatgctaatgatattgaattgcaccgctttgtgaaccttggtattgccgtaggt
cttgatgatggtcttatcgttcctgttatccatggggctaacaagatgtgcttgtcagat
ttcgtgcttgcttcaaaagatgtgattaaaaaagcgcaaactggtaagttgaaagcagct
gaaatgtctggatcaaccttctctatcacaaacttgggaatgtttggtacgaagacattt
aacccaattattaaccaaccaaactcagcaattcttggtgttggagcaactatcccaact
ccaacggttgtggatggtgagattgtttcccgtccaattatggcaatgtgcctaaccatc
gaccaccgtttagttgatggtatgaacggtgcaaaattcatggttgatctcaagaaattg
atggaaaatccatttgaattgttaatctga

DBGET integrated database retrieval system