KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1233
Entry
SPy_1233          CDS       T00050                                 

Gene name
coaA
Definition
(GenBank) putative pantothenate kinase
  KO
K00867  type I pantothenate kinase [EC:2.7.1.33]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00770  Pantothenate and CoA biosynthesis
spy01100  Metabolic pathways
spy01240  Biosynthesis of cofactors
Module
spy_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SPy_1233 (coaA)
Enzymes [BR:spy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     SPy_1233 (coaA)
SSDB
Motif
Pfam: PRK CoaE
Other DBs
NCBI-ProteinID: AAK34090
UniProt: Q99ZH1
LinkDB
Position
1016673..1017593
AA seq 306 aa
MSNEFINFEKISRESWKTLHQKAKALLTQEELKSITSLNDNISINDVIDIYLPLINLIQV
YKIAQENLSFSKSLFLKKDIQLRPFIIGISGSVAVGKSTTSRLLQLLLSRTHPNSQVELV
TTDGFLYPNQFLIEQGLLNRKGFPESYNMELLLDFLDSIKNGQTAFAPVYSHDIYDIIPN
QKQSFNNPDFLIVEGINVFQNQQNNRLYMSDYFDFSIYIDADSSHIETWYIERFLSILKL
AKRDPHNYYAQYAQLPRSEAIAFARNVWKTVNLENLEKFIEPTRNRAELILHKSADHKID
EIYLKK
NT seq 921 nt   +upstreamnt  +downstreamnt
atgtcaaatgaatttattaactttgaaaaaatttctagagagtcttggaaaacattacat
caaaaggcaaaagctctcctcacacaagaggaacttaaaagtattactagcttaaatgat
aacatcagtattaacgatgtcattgatatctaccttccattaattaatctgatccaggtt
tacaaaattgcgcaagaaaatctttctttttctaaaagcctttttctaaaaaaagacatt
caattaaggccttttattattggaatttctggttcagtagctgttggtaaatcaacaact
agtcgtcttttacaacttttattatcacgaacgcaccccaatagtcaagtcgaactggta
acgactgatggttttttatatcctaatcagtttcttattgaacaaggactgttaaatcgt
aaaggatttccagaatcttataacatggaacttctcttagattttctagattccatcaaa
aatggtcaaactgcttttgcacccgtctattctcatgatatttacgatattatcccaaat
caaaaacaatcatttaataaccctgacttccttatcgtcgaaggtattaacgtttttcaa
aatcaacaaaacaatcgtttatatatgagtgattactttgatttttctatttatattgat
gcagacagcagtcacatcgaaacctggtacattgaacggtttctaagcattttaaaatta
gcaaaacgtgaccctcataattattatgcccaatatgcacaattacctcgatctgaggct
atagcatttgcgcgcaacgtttggaaaaccgttaatttagaaaatcttgaaaaattcatt
gaacctacacgtaaccgtgctgaattaattttacataaaagtgctgatcataaaattgat
gaaatttacctcaaaaagtga

DBGET integrated database retrieval system