KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1359
Entry
SPy_1359          CDS       T00050                                 

Gene name
metK
Definition
(GenBank) S-adenosylmethionine synthetase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00270  Cysteine and methionine metabolism
spy01100  Metabolic pathways
spy01110  Biosynthesis of secondary metabolites
spy01230  Biosynthesis of amino acids
spy01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SPy_1359 (metK)
Enzymes [BR:spy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     SPy_1359 (metK)
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Other DBs
NCBI-ProteinID: AAK34187
UniProt: Q99Z77
LinkDB
Position
complement(1125325..1126521)
AA seq 398 aa
MSERKLFTSESVSEGHPDKIADQISDAILDAILAEDPEAHVAAETCVYTGSVHVFGEIST
TAYIDINRVVRDTIAEIGYTEAEYGFSAESVGVHPSLVEQSGDIAQGVNEAFESREGDTD
DLSHIGAGDQGLMFGFAINETPELMPLPISLSHQLVRRLAELRKSGEISYLRPDAKSQVT
VEYDEHDKPVRVDTVVISTQHDPEATNDQIRQDVIEKVIKAVIPADYLDDDTKFFINPTG
RFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNLVAA
GLVTKAEVQLAYAIGVAQPVSVRVDTFGTSTVPEAVLEAAVRQVFDLRPAGIIQMLDLKR
PIYKQTAAYGHMGRTDIDLPWERLNKVDALVEAVKTVL
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgtcagaacgtaaacttttcacgtctgagtccgtatctgaagggcatccagataagatt
gcagaccaaatttcagatgctattttagatgccattttagcagaagatccagaagcccat
gtggctgcagaaacttgtgtttacacaggttctgttcatgtttttggagaaatctcaaca
acagcatacattgatattaaccgtgtggtccgcgacaccattgcagaaattggttataca
gaagcagaatatggcttttcagcagaatcagtgggagtacatccatcacttgtagaacaa
tctggagatatcgctcagggggttaatgaagctttcgaaagcagagaaggtgatactgat
gaccttagccatattggagcgggtgaccaagggctcatgtttggttttgccatcaatgaa
acaccagaattgatgcctttaccaatttccttatctcaccaattagtgcgtcgcttggcg
gaattacgtaagtcaggtgagattagttatctacgtccagatgctaaatctcaagtgaca
gttgagtacgatgaacacgataaacctgttcgtgtggatacagtcgttatttctactcag
catgatccagaagctactaatgaccaaattcgtcaggatgtgattgaaaaagtgatcaag
gctgtaattccagcagattatttagatgatgacacaaagttcttcattaatccaacagga
cgttttgttattggaggtccgcaaggagactctggattgaccggacgtaagattattgtg
gatacctatggaggctattcacgtcatggtggcggtgctttttcaggaaaagatgcgaca
aaagtggaccgttcggcttcttacgctgctcgctatattgctaaaaaccttgtggcagca
ggccttgtgaccaaagctgaagtccaactagcttatgcgattggggtggctcagcctgtg
tctgttcgcgtggatacatttggaacctcaacggttcctgaagctgttttagaagctgct
gttcgtcaagtctttgatttacggccagcaggcattattcaaatgcttgatttaaaacgc
ccgatttacaaacaaacagctgcctatggtcacatggggagaacagatattgatttgcca
tgggagcgtttaaataaggttgatgctttagtagaagctgtaaaaacagtattataa

DBGET integrated database retrieval system