KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1362
Entry
SPy_1362          CDS       T00050                                 

Gene name
birA
Definition
(GenBank) putative biotin operon repressor
  KO
K03524  BirA family transcriptional regulator, biotin operon repressor / biotin---[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00780  Biotin metabolism
spy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SPy_1362 (birA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:spy03000]
    SPy_1362 (birA)
Enzymes [BR:spy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.15  biotin---[biotin carboxyl-carrier protein] ligase
     SPy_1362 (birA)
Transcription factors [BR:spy03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    SPy_1362 (birA)
SSDB
Motif
Pfam: HTH_11 BPL_C BPL_LplA_LipB HTH_24 Fe_dep_repress HTH_36 HTH_1 GntR HTH_Crp_2
Other DBs
NCBI-ProteinID: AAK34189
UniProt: Q99Z75
LinkDB
Position
1129640..1130581
AA seq 313 aa
MKTSEKIYQLLSQTDDFVSGEYLADQLSISRTSVWKSIKSLENQGIQIDSLKHKGYRMVQ
GDILLPKTISQGLGMPVTYTPHSQSTQLDAKQGIEAHNSAPRLYLAPSQEAAKGRLDRQF
FSASTGGIYMSMYLKPNVPYADMPPYTMMVASSIVKAISRLTGIDTEIKWVNDIYLGNHK
VAGILTEAITSVETGLITDVIIGVGLNFFVTDFPEAIAQKAGSLFTEKPTITRNDLIIDI
WKLFLSIPVKDHVKVYKEKSLVLNKQVTFIENSQEKRAIAIDLTDQGHLIVQFENGDLQT
LRSGEISLSSWEN
NT seq 942 nt   +upstreamnt  +downstreamnt
atgaaaacatcagaaaaaatttatcaattactgtcacaaaccgatgacttcgtcagtggg
gaatatctagcagatcaactcagtatctctcgtacatccgtttggaaatccatcaaaagt
ctcgaaaatcaggggattcaaattgattctttaaaacacaagggctaccgcatggtacaa
ggtgatattttattacccaaaaccattagccaagggcttgggatgccagtcacctatacc
cctcacagccaatctacccaattagatgccaaacaaggaatcgaagctcataacagcgct
ccaaggctttacctagctcctagccaagaagctgccaaaggacgcctcgatcggcaattt
ttttcagctagcaccggtggtatttacatgtccatgtacctaaaacccaatgtcccttat
gctgatatgcctccttatacgatgatggttgcttccagtattgtcaaagctatctcgcga
ttaacaggcattgatacagaaatcaaatgggtaaacgacatctatctaggtaaccataaa
gttgcagggattctgacagaagccattacttctgttgaaactggtttaatcaccgatgtc
attattggggttggtctcaacttttttgtcaccgacttcccagaagcgattgctcaaaag
gcaggttctctctttaccgaaaaaccgactatcacgcgcaatgaccttatcattgacatc
tggaaattattcttatctattcctgtcaaggaccatgtcaaagtttacaaagaaaaatca
cttgttcttaataaacaagtgacctttatagaaaatagtcaagaaaaacgtgctattgcg
attgatctcacagatcaaggacacctcattgtacagtttgaaaatggtgaccttcaaacc
ttgcgaagcggtgaaatcagtctttcttcttgggagaattag

DBGET integrated database retrieval system