KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1406Help
Entry
SPy_1406          CDS       T00050                                 

Gene name
sodA
Definition
(RefSeq) superoxide dismutase (Fe/Mn)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Brite
Enzymes [BR:spy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SPy_1406 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 901469
NCBI-ProteinID: NP_269500
UniProt: P0C0I1
LinkDB All DBs
Position
complement(1164943..1165548)
Genome map
AA seq 201 aa AA seqDB search
MAIILPELPYAYDALEPQFDAETMTLHHDKHHATYVANTNAALEKHPEIGENLEELLADV
TKIPEDIRQTLINNGGGHLNHALFWELLSPEKQDVTPDVAQAIDDAFGSFDAFKEQFTAA
ATGRFGSGWAWLVVNKEGQLEITSTANQDTPISEGKKPILALDVWEHAYYLNYRNVRPNY
IKAFFEIVNWKKVSELYQAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttaccagaacttccatacgcgtatgatgctcttgaaccacagtttgat
gcggagacaatgactcttcatcatgataaacaccatgccacttatgtcgctaataccaat
gcggctttagaaaaacacccagagatcggagaaaatctggaggaactattggcagatgtc
actaagattccagaagatattcgtcaaaccttaattaataatggtggcggacacctaaac
catgcgcttttctgggaactattatcacctgaaaaacaagacgtcactcctgatgttgca
caagccattgatgatgcttttgggtcatttgacgcctttaaagaacaatttacagcagct
gctactggacgttttggttcaggttgggcatggttagttgttaataaagaaggacaactc
gaaatcacatcaaccgctaaccaagatactccaatttcagaaggcaaaaaaccaattcta
gcgcttgatgtgtgggagcatgcttactacttgaattatcgtaatgtacgtccaaattat
atcaaagctttctttgaaatcgttaattggaaaaaagtatcagaactttaccaagccgct
aaataa

DBGET integrated database retrieval system