KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1682Help
Entry
SPy_1682          CDS       T00050                                 

Gene name
glpF
Definition
(RefSeq) putative glycerol uptake facilitator
  KO
K02440  glycerol uptake facilitator protein
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Brite
KEGG Orthology (KO) [BR:spy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spy02000]
    SPy_1682 (glpF)
Transporters [BR:spy02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    SPy_1682 (glpF)
Ion channels [BR:spy04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   SPy_1682 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 901928
NCBI-ProteinID: NP_269717
UniProt: Q99YI9
LinkDB All DBs
Position
complement(1395880..1396581)
Genome map
AA seq 233 aa AA seqDB search
MDIFGEFLGTALLVLLGNGVVAGVVLPKTKTHASGWIVIATGWGIAVAVAVFISGKVAPA
HLNPAVSLAFAMSGTIAWSTAIAYSLAQLLGAMVGSTLVFLQFRPHYLAAESQADILGTF
ATGPAIRDTSSNLLSEIFGTFVLMLGILAFGLYDMPAGLGTLCVGTLVIGIGLSLGGTTG
YAINPARDLGPRLVHAILPLNNKGDSDWSYAWIPVVGPIIGAVLAVLLFQVMS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggatatctttggcgaatttttgggtacagccttattggttttactaggaaatggtgtg
gtagcaggggttgtcttgcccaaaacgaaaacccatgcttctggctggatcgtgattgcg
actggctggggaattgcagttgctgtggcagtctttatcagtggcaaagttgcccctgcc
cacctcaatccagctgttagccttgcttttgccatgagtggaaccattgcctggtcaaca
gccattgcctatagccttgcccaactattgggagctatggttggttcaactctggtattc
cttcagttcaggccacattatctggctgctgagagtcaggctgatattttagggacattt
gcgacaggtcctgctattcgagatactagctcaaacctattgagtgaaatctttgggacc
tttgtcttgatgcttggtattttggcatttggcttatatgatatgccagcaggactagga
accctctgtgtaggtaccttggttattgggattgggttatccttaggaggaacgacaggt
tacgccattaacccagcacgtgatttaggacctcgtctagttcatgctattctaccactc
aacaacaagggagattctgattggtcttatgcttggatacctgttgtaggaccaattatt
ggagcggtcttagcagttttgcttttccaagtcatgtcctaa

DBGET integrated database retrieval system