KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1748
Entry
SPy_1748          CDS       T00050                                 

Gene name
fabF
Definition
(GenBank) putative beta-ketoacyl-ACP synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00061  Fatty acid biosynthesis
spy00780  Biotin metabolism
spy01100  Metabolic pathways
spy01212  Fatty acid metabolism
spy01240  Biosynthesis of cofactors
Module
spy_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SPy_1748 (fabF)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SPy_1748 (fabF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spy01004]
    SPy_1748 (fabF)
Enzymes [BR:spy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     SPy_1748 (fabF)
Lipid biosynthesis proteins [BR:spy01004]
 Fatty acid synthase
  Component type
   SPy_1748 (fabF)
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N DUF2384
Other DBs
NCBI-ProteinID: AAK34492
UniProt: Q99YD7
LinkDB
Position
complement(1449021..1450253)
AA seq 410 aa
MTFKRVVVTGYGLTSPIGHDPETFWNNLKAGQIGIGPITKFDTTDYAVKNAAEIQDFPFD
KYFVKKDLNRFDRYSLYALYAAKEAINHADLNIEMVDSDRFGVIVASGIGGIAEIEEQVI
RLHEKGPKRVKPMTLPKALPNMAAGNVAMSLKAQGVCKSINTACASSNDAIGDAFRAIKF
GTQDVMIVGGSEAAITKFAIAGFQSLTALSTTEDPSRSSIPFDKDRNGFIMGEGSGMLVL
ESLEHAQERGATILAEIVGYGNTCDAYHMTSPNPEGLGARKAIHLALQEAGIEASAINYV
NAHGTSTPANEKGESQAIVAVLGKDVPVSSTKSFTGHLLGAAGAIEAIATIEAMRHNYVP
MTAGTQALSEDIEANVIFGEGKETAINYAISNTFGFGGHNAVLAFKCWEE
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgacatttaaaagagtagtggtaacaggttatggtctaacatctccaatcgggcatgat
cctgaaacgttttggaacaatctgaaagctggccaaattggtattggtcctattactaaa
tttgacacgactgattatgcagtcaagaatgctgctgaaattcaggattttccatttgac
aaatactttgtgaaaaaagatttgaaccgtttcgatagatattctctttatgctctttac
gcagcgaaagaggctattaatcatgctgatttaaatattgagatggttgattccgatcga
tttggcgttattgttgcttcaggtattggtggaattgcggagattgaagagcaagtgatt
cgcttacatgaaaaagggccaaaacgtgtgaagccaatgacgttgccaaaagcgctacca
aatatggctgcaggaaatgtcgccatgtctttaaaagctcaaggagtatgtaaatcaatt
aatactgcctgcgcttcttcaaatgatgcgattggggatgcctttcgtgccattaaattt
gggactcaagatgtgatgatagttggtgggtcagaggcggccataaccaagtttgccatt
gctggcttccaaagtttaacagctctctcaacaactgaagatccaagcagaagctctatt
ccatttgataaagaccgcaatggttttatcatgggagaaggatcaggaatgcttgtttta
gaaagcctagaacatgcgcaagaacgcggggcgacaatcttagcagaaattgtgggttat
ggaaatacctgcgatgcctaccatatgacatctccaaatcctgagggattaggagctcgt
aaagccatccacttagccttacaagaagctggtattgaagccagtgctattaattatgtc
aatgcgcacggaacttcaaccccagctaatgaaaaaggagagagtcaagcaattgtagcc
gttcttggtaaggatgttccggtgtcttcaacaaaatcgtttacgggtcaccttcttgga
gcagcaggcgctattgaagctattgccactatcgaggctatgcgtcataactatgttccg
atgacggctgggacacaagctttatcagaggatatcgaagcaaatgtcatctttggagaa
ggaaaagaaacagctatcaactatgccatttcaaatacttttggatttggtggtcataat
gctgtattagctttcaaatgttgggaggagtag

DBGET integrated database retrieval system