KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_2080Help
Entry
SPy_2080          CDS       T00050                                 

Gene name
nox1
Definition
(RefSeq) putative NADH oxidase/alkyl hydroperoxidase reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Brite
KEGG Orthology (KO) [BR:spy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPy_2080 (nox1)
Enzymes [BR:spy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SPy_2080 (nox1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 GIDA FAD_oxidored HI0933_like Thi4 Glutaredoxin DAO FAD_binding_3 AlaDh_PNT_C Lycopene_cycl Thioredoxin_4 NAD_binding_8 LPD7 FMO-like K_oxygenase
Motif
Other DBs
NCBI-GeneID: 901721
NCBI-ProteinID: NP_270012
UniProt: Q99XR6
LinkDB All DBs
Position
1729645..1731177
Genome map
AA seq 510 aa AA seqDB search
MALSPDIKEQLAQYLTLLEADLVLQVSLGDNEQSQKVKDFVEEIAAMSERISIENITLDR
QPSFKVAKKGHGSGVVFAGLPLGHELTSFILALLQVSGRAPKVDQDVIDRIKAIDRPLHF
ETYVSLTCHNCPDVVQALNIMSVLNDKISHTMVEGGMFQDEVKAKGIMSVPTVFLDGEEF
TSGRATIEQLLEQIAGPLSEEAFADKGLYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
FGGQVMETVGIENMIGTLYTEGPKLMAEVEAHTKSYDVDIIKAQLATSIEKKENIEVTLA
NGAVLQAKTAILALGAKWRNINVPGEDEFRNKGVTYCPHCDGPLFEGKDVAVIGGGNSGL
EAALDLAGLAKHVYVLEFLPELKADKVLQDRAAKTNNMTIIKNVATKDIVGEDHVTGLNY
TERDSGEDKHLDLEGVFVQIGLVPNTAWLKDSGVNLTDRGEIIVDKHGSTNIPGIFAAGD
CTDSAYKQIIISMGSGATAAIGAFDYLIRQ
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtcctgatattaaagaacaacttgcccaatacctcaccctgttagaagct
gatcttgttttgcaagtttcccttggtgacaatgagcagtctcaaaaagtcaaagacttt
gtggaagaaatagctgctatgtctgagcgtatttctattgaaaacatcactttagaccga
caaccaagctttaaggttgcgaaaaaaggtcacggtagtggggttgtctttgctggtctt
cctttaggccacgaattgacgtcctttattcttgctctcttgcaagtatctggacgtgct
ccaaaagtggatcaagatgttattgatcgcatcaaggccattgaccgtccgttgcatttt
gaaacttatgtcagcttaacctgccataactgcccagatgttgttcaagctttaaacatt
atgtccgtcttgaacgacaagatttcacacactatggtagaaggcggcatgttccaagat
gaagtgaaagcaaaaggcattatgtctgtccctactgtctttttagacggggaagaattc
acttctggtcgcgctaccattgagcaactcttagaacaaatcgctggcccactttctgag
gaagcctttgctgataaaggcctctatgatgtccttgttattggtggtggccctgcgggc
aatagcgctgctatctatgcagctcgtaaaggactaaaaacaggtttacttgctgaaacc
tttggtggtcaggtcatggaaacggtcggcatcgaaaacatgattggtaccctttacact
gaaggaccaaaattaatggccgaagtggaggcccatactaagtcttatgatgttgatatt
atcaaagcacaactagctacttctattgagaaaaaagaaaacatcgaggttactctagct
aatggtgcggttctacaagccaaaactgctatcttagctcttggggccaaatggcgtaac
attaatgttcctggtgaagatgaattccgtaataaaggggtgacttactgccctcactgt
gacggtcctctctttgaaggcaaagatgttgctgttatcggtggtgggaactctggatta
gaagcggcccttgacttggctggtcttgctaaacacgtttacgttttagaattcttgcct
gaacttaaagctgacaaagtgcttcaagaccgcgcagctaagactaacaatatgaccatc
atcaaaaatgttgctactaaggacattgttggagaggaccatgttacaggtcttaactac
actgagcgtgatagcggtgaagacaaacaccttgaccttgaaggggtctttgttcaaatt
ggtcttgttccaaacacagcttggctcaaagatagtggtgtcaacctaaccgaccgcgga
gaaatcattgtggataaacatgggtcaaccaatattcctggtatctttgctgctggggac
tgtactgattcagcttataaacaaatcattatttccatggggtctggtgctactgctgcc
atcggtgcctttgactacttgattcgtcaataa

DBGET integrated database retrieval system