KEGG   Streptococcus pyogenes A20 (serotype M1): A20_0203Help
Entry
A20_0203          CDS       T02335                                 

Gene name
ulaE
Definition
(GenBank) L-ribulose-5-phosphate 3-epimerase ulaE
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
spya  Streptococcus pyogenes A20 (serotype M1)
Pathway
spya00040  Pentose and glucuronate interconversions
spya00053  Ascorbate and aldarate metabolism
spya01100  Metabolic pathways
spya01120  Microbial metabolism in diverse environments
Module
spya_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:spya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A20_0203 (ulaE)
   00053 Ascorbate and aldarate metabolism
    A20_0203 (ulaE)
Enzymes [BR:spya01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     A20_0203 (ulaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 PRMT5_TIM Radical_SAM CBM_26
Motif
Other DBs
NCBI-ProteinID: AFV37296
LinkDB All DBs
Position
163693..164556
Genome map
AA seq 287 aa AA seqDB search
MARPIGIYEKATPKQFTWRERLQFAKDLGFDFVEMSVDESDARLARLEWTKEERLDLVKA
IYETGIRIPTICFSGHRRYPLGSNDPAIEAKSLKLMKQCIELAQDLGVRTIQLAGYDVYY
EEKSPETRARFIKNLRQSCDWAEEAQVMLSIEIMDDPFINSIEKYLAVEKEIDSPYLFVY
PDAGNVSAWHNDLWSEFYNGHKSIAALHLKDTYAVTETSKGQFRDVPFGQGCVDWQELFA
VLKKTNYNGPFLIEMWSENCDTVEETKAAIKEAQDFLYPLIEKAGLA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtcctattggtatttatgaaaaagcaacgccaaaacagtttacctggcgtgaa
cgcttgcaatttgcaaaagacttaggttttgattttgtggaaatgtctgttgatgaatca
gatgctcgcttagcgcgcttagagtggactaaggaagaacggcttgatttagtgaaagcc
atttatgaaacaggcattcgcatcccgaccatttgtttttctggtcatagacgttaccca
ctaggctcaaatgatcctgctattgaagccaagtcccttaaactgatgaaacaatgtatt
gaattggcacaggacttaggcgttcgtaccattcaattagctggttatgacgtttactat
gaagaaaaatcgcctgaaacccgtgctcgttttatcaaaaacttgagacaatcttgtgac
tgggccgaagaagcccaagtgatgctttctattgagattatggatgacccttttatcaac
tctattgaaaaatacttggcagttgaaaaagagattgactcgccttatctctttgtttat
cctgatgcaggcaatgtttctgcctggcataatgatttgtggagtgaattttacaatggt
cacaagtccattgcagccctccacttgaaagatacttatgctgtcacggaaacctcaaaa
gggcagtttcgtgatgtgccatttggtcaaggttgtgtggactggcaagagctgtttgcg
gtcctcaagaaaaccaactacaatgggccttttttgattgaaatgtggtcagaaaattgt
gacacggtggaggaaacaaaagctgctatcaaagaagctcaggacttcctttacccactt
attgagaaagcggggttggcataa

DBGET integrated database retrieval system