KEGG   Streptococcus pyogenes A20 (serotype M1): A20_1192cHelp
Entry
A20_1192c         CDS       T02335                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spya  Streptococcus pyogenes A20 (serotype M1)
Pathway
spya00473  D-Alanine metabolism
spya00550  Peptidoglycan biosynthesis
spya01100  Metabolic pathways
spya01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spya00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A20_1192c (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A20_1192c (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A20_1192c (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spya01011]
    A20_1192c (ddl)
Enzymes [BR:spya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A20_1192c (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:spya01011]
 Precursor biosynthesis
  Amino acid ligase
   A20_1192c (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AFV38274
LinkDB All DBs
Position
complement(1135023..1136069)
Genome map
AA seq 348 aa AA seqDB search
MSKQTLVLLYGGRSAEREVSVLSAESVMRAVNYDKFLVKTYFITQMGQFIKTQQFSEKPS
ESERLMTNETIELTQKIKPSDIYEEGAVVFPVLHGPMGEDGSIQGFLEVLRMPYIGTNVM
SSSIAMDKITTKRVLESIGIPQVAYTVYIDGQDLEACLVETLARLTFPIFVKPANMGSSV
GISKAQTKVELRKAIQLALTYDSRVLIEQGVVAREIEVGLLGNDKVKSTLPGEVIKDVDF
YDYQAKYVDNKITMAIPADVDQSIVTEMRSYAEVAFKALGGCGLSRCDFFLTQDGQVYLN
ELNTMPGFTQWSMYPLLWENMGLAYPDLIEELVTLAQEMFDQRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacaaacgttagttctattatacggaggccgctcagcagaacgtgaagtctca
gtgctttcagcagagagtgtgatgcgagcagtcaactatgataagttcttagtaaaaact
tattttattactcagatgggccaatttatcaaaactcagcaattttcagaaaagccatcg
gaatcagaacgcttgatgacaaatgagacgatagagctaactcaaaaaataaaaccaagt
gatatctatgaagaaggtgcagttgtatttcctgtattacatggacctatgggagaagat
ggctctatccaaggtttcttagaagtgcttagaatgccatatatagggactaatgtcatg
tcttctagcatagctatggataaaattactactaaacgtgtcttagaatcaattggaatt
ccacaagttgcctatactgtttatattgacggacaagatttggaggcttgtttagttgaa
actttagcaagacttacttttcctatcttcgtaaaaccagctaatatgggttcttctgtg
gggatttccaaagcccaaacaaaagtagaattaagaaaagcgattcagttagccctgacc
tatgacagtcgtgtcttgattgaacaaggcgtggttgcaagagaaattgaagttggtctc
cttggaaatgataaggttaaatcaactctaccaggagaagtaatcaaggacgttgatttt
tacgactaccaggcaaaatatgttgacaataagattacgatggccattccagcagatgta
gaccagagtattgtgacagaaatgcgttcttatgctgaagtagcctttaaagccttaggt
ggttgtgggttgtcccgttgtgactttttcttgacccaagatggacaggtttaccttaat
gaattaaacaccatgccaggctttacccaatggtctatgtatccactcttatgggaaaat
atgggattggcttatccagatttgattgaagagctggtgacactggcacaagaaatgttt
gaccagcgtgagagccacctgatttaa

DBGET integrated database retrieval system