KEGG   Streptococcus pyogenes A20 (serotype M1): A20_1378cHelp
Entry
A20_1378c         CDS       T02335                                 

Gene name
prkC
Definition
(GenBank) serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
spya  Streptococcus pyogenes A20 (serotype M1)
Brite
KEGG Orthology (KO) [BR:spya00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spya01001]
    A20_1378c (prkC)
Enzymes [BR:spya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     A20_1378c (prkC)
Protein kinases [BR:spya01001]
 Serine/threonine kinases: Other
  Bacterial family
   A20_1378c (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Kinase-like Haspin_kinase FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AFV38447
LinkDB All DBs
Position
complement(1299355..1301253)
Genome map
AA seq 632 aa AA seqDB search
MIQIGKLFAGRYRILKSIGRGGMADVYLANDLILDNEDVAIKVLRTNYQTDQVAVARFQR
EARAMAELNHPNIVAIRDIGEEDGQQFLVMEYVDGADLKRYIQNHAPLSNNEVVRIMEEV
LSAMTLAHQKGIVHRDLKPQNILLTKEGVVKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATIQSDIYAMGIMLFEMLTGHIPYDGDSAVTIALQHFQKPLPSIIEENHNVP
QALENVVIRATAKKLSDRYGSTFEMSRDLMTALSYNRSRERKIIFENVESTKPLPKVASG
PTASVKLSPPTPTVLTQESRLDQTNQTDALQPPTKKKKSGRFLGTLFKILFSFFIVGVAL
FTYLILTKPTSVKVPNVAGTSLKVAKQELYDVGLKVGKIRQIESDTVAEGNVVRTDPKAG
TAKRQGSSITLYVSIGNKGFDMENYKGLDYQEAMNSLIETYGVPKSKIKIERIVTNEYPE
NTVISQSPSAGDKFNPNGKSKITLSVAVSDTITMPMVTEYSYADAVNTLTALGIDASRIK
AYVPSSSSATGFVPIHSPSSKAIVSGQSPYYGTSLSLSDKGEISLYLYPEETHSSSSSSS
STSSSNSSSINDSTAPGSNTELSPSETTSQTP
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgattcagattggcaaattatttgctggtcgttatcgcattctgaaatctattggccgc
ggtggtatggcggatgtttatttagcaaatgacttgatcttggataatgaagacgttgca
atcaaggtcttgcgtaccaattatcaaacagatcaggtagcagttgcgcgtttccaacga
gaagcgcgggccatggctgaattgaaccatcccaatattgttgccatccgggatataggt
gaagaagacggacagcaatttttagtaatggaatatgtggatggtgctgacctaaagaga
tacattcaaaatcatgctccattatctaataatgaagtggttagaattatggaagaagtc
ctttctgctatgactttagcccaccaaaaaggaattgtacacagagatttaaaacctcaa
aatatcctactaactaaggagggtgttgtcaaagtaactgatttcggcatcgcagtagcc
tttgcagaaacaagcttgacacaaactaattcgatgttaggcagtgttcattacttgtct
ccagaacaggctcgcggctccaaagcgacgattcaaagtgatatttatgcgatggggatt
atgctctttgagatgttgacaggccatatcccttatgacggcgatagtgctgttacgatt
gccttgcaacattttcaaaagcctcttccatctattatcgaggagaaccacaatgtgcca
caagctttggagaatgttgttattcgagcaacagccaagaaattaagtgatcgttacggg
tcaacctttgaaatgagtcgtgacttaatgacggcgcttagttataatcgtagtcgggag
cgtaagattatctttgagaatgttgaaagtaccaaacccctccccaaagtggcctcaggt
cccaccgcttctgtaaaattgtctccccctaccccaacagtgttaacacaggaaagtcga
ttagatcaaactaatcaaacagatgctttacagccccccaccaaaaagaaaaaaagtggt
cgttttttaggtactttattcaaaattcttttttctttctttattgtaggtgtagcactc
tttacttatcttatactaactaaaccaacttctgtgaaagttcctaatgtagcaggcact
agtcttaaagttgccaaacaagaactgtatgatgttgggctaaaagtgggtaaaatcagg
caaattgagagtgatacggttgctgagggaaatgtagttagaacagatcctaaagcagga
acagctaagaggcaaggctcaagcattacgctttatgtgtcaattggaaacaaaggtttt
gacatggaaaactacaaaggactagattatcaagaagctatgaatagtttgatagaaact
tatggtgttccaaaatcaaaaatcaaaattgagcgcattgtaactaatgaatatcctgaa
aatacagtcatcagtcaatcgccaagtgcgggtgataaatttaatccaaacggaaagtct
aaaattacgctcagtgttgctgttagtgatacgatcactatgcctatggtaacagaatat
agttatgcagatgcagtcaataccttaacagctttaggtatagatgcatctagaataaaa
gcttatgtgccaagctctagctcagcaacgggctttgtgccaattcattctcctagttct
aaagctattgtcagtggtcaatctccttactatggaacgtctttgagtttgtctgataaa
ggagagattagtctttacctttatccagaagaaacacactcttctagtagctcatcgagt
tcaacgtcaagttcaaacagttcttcaataaatgatagtactgcaccaggtagcaacact
gaattaagcccatcagaaactacttctcaaacaccttaa

DBGET integrated database retrieval system