KEGG   Sphingobium sp. YG1: YGS_C1P0614Help
Entry
YGS_C1P0614       CDS       T05858                                 

Definition
(GenBank) aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
spyg  Sphingobium sp. YG1
Pathway
spyg00970  Aminoacyl-tRNA biosynthesis
spyg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spyg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YGS_C1P0614
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spyg03029]
    YGS_C1P0614
Enzymes [BR:spyg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     YGS_C1P0614
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     YGS_C1P0614
Mitochondrial biogenesis [BR:spyg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    YGS_C1P0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: BBC99358
UniProt: A0A2Z6ABM6
LinkDB All DBs
Position
1:625100..626605
Genome map
AA seq 501 aa AA seqDB search
MTESTYRIQGATGEWEVVIGLEVHAQVTSNAKLFSGAATAFGAEPNTQVSLVDAAMPGML
PVPNMECIRQAVRTGMAIDAQINKWSRFDRKNYFYADLPQGYQISQLYHPIVGEGQIEIV
LDEKNPDASKKVIGVERIHVEQDAGKLMHDQHPTSSYVDLNRSGVALMEIVSKPDMRSPA
EAGAYLSKLRTILRYVGSCDGNMDQGSMRADVNVSVRRPGEEFGTRTETKNVNSVRFVMA
VVEHEASRQVDVLEAGGKIVQETRLYDPDRNETRSMRSKEDAHDYRYFPDPDLLPLELDD
AFLEACRQSLPELPDAKLRRYAQDLGLSAYNAATLTADADTARWFEALLAEAARIQKKSE
GDVAKASANWLLSELYGALNRIGKSLEDSPVSPEEGAELLALVADGTISGTIAKQVFEIM
LETGEKPGKIVEDKGLKQTSDTGAIEAAVADVLAKNGDKVEQYRGGKEALFGFFVGQTMK
AMQGKANPQVVNEMVKKALSA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatcaacctatcgcatccagggtgcaaccggcgagtgggaggtcgtgatcggc
ctggaagtccatgcgcaggtgacgtcgaacgccaagctgttttcgggcgcggccaccgcg
ttcggcgcggagcccaatacccaggtcagcctggtcgacgcggccatgcccggcatgctg
cccgtgccgaacatggagtgcatccgtcaggcggtgcgcaccggcatggcgatcgacgcg
cagatcaacaaatggtcgcggttcgaccggaagaattatttctacgccgatctgccgcag
ggctaccagatcagccagctttaccacccgatcgtgggtgaggggcagatcgagatcgtg
ctggacgagaagaacccggacgccagcaagaaggtgatcggcgtcgagcgtatccatgtc
gagcaggatgccggcaagctgatgcacgaccagcaccccacgagcagctatgtcgacctc
aaccggtcgggcgtggcgctgatggaaatcgtgtcgaagccggacatgcgttcgcctgcc
gaagcaggggcttatctctcgaagctgcggacgatcctgcgctatgtcgggtcgtgcgac
ggcaatatggatcagggatcgatgcgcgccgacgtgaacgtctccgtacgtcgtcctggc
gaggaattcggtacgcggaccgagacgaagaacgtcaattcggtgcgcttcgtcatggcc
gtggtcgagcatgaagcgagccgtcaggtcgacgtgctggaggccggtggcaagatcgtg
caggaaacccgcctctacgatccggaccggaacgagacgcgctcgatgcggtcgaaggaa
gatgcgcacgactatcgctatttccccgatcccgacctgttgccgctggaactggacgac
gccttcctggaggcatgccgccagtcgctgccggaactgcccgacgccaagctgcgtcgc
tatgcgcaggatctgggcctgagcgcctataatgccgcgactttgaccgccgacgccgac
acggcccgctggttcgaggcgctgctggccgaagccgcgcgtatccagaagaagagcgag
ggcgacgtcgccaaggcttcggccaactggctgctgtcggaactttatggtgcgctcaac
cgcattggcaagtcgttggaagacagcccggtaagccccgaggaaggggccgaattgctg
gcgctggtggccgatggcacgatcagcgggacgatcgccaagcaggtgttcgagatcatg
ctggaaaccggcgagaagccgggcaagatcgtcgaggacaagggcctgaagcagacgtcc
gataccggcgcgatcgaggcggcggtggccgacgtgctggcgaagaatggcgacaaggtc
gagcagtatcgcggcggcaaggaagcgctgttcggcttcttcgtcggccagacgatgaag
gcgatgcagggcaaggccaatccgcaggtcgtcaacgaaatggtgaagaaggcgctgtcg
gcttaa

DBGET integrated database retrieval system