KEGG   Sphingobium sp. YG1: YGS_C1P0831Help
Entry
YGS_C1P0831       CDS       T05858                                 

Definition
(GenBank) bifunctional non-homologous end joining protein LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
spyg  Sphingobium sp. YG1
Pathway
spyg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:spyg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    YGS_C1P0831
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spyg03400]
    YGS_C1P0831
Enzymes [BR:spyg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     YGS_C1P0831
DNA repair and recombination proteins [BR:spyg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     YGS_C1P0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: BBC99575
UniProt: A0A2Z6AC74
LinkDB All DBs
Position
1:complement(885467..887845)
Genome map
AA seq 792 aa AA seqDB search
MQKHAATRLHYDFRLELDGTLVSWAVTRGPSANPDDKRLAVRTEDHPLDYARFEGTIPKG
EYGGGTVMLWDNGTWDPVPGKDPTKTLAEGHLHFTLHGRRMKGEWIMFRLKPRGKEKGEN
WILRKVEDEFAGGSDDLIGIHLTSVDSGRTMEEIAAGEPIRRQGGKAKAPATTPKSSTAA
ARKGKNKGKLPPFQPVQLAALVDHVPPGDRWLHELKYDGYRTLIAVGGGEGRAYTRSGLD
WSDRFADIITEAAQLDVGSALIDGEAVVTLPDGRTSFQALQAALKDNPGTIDYFAFDLLE
LNGEDLTSLPLIERKEKLASILEGHKGRLRYSDHIVGNGEKLLTSFCEAGLEGVISKRVD
ARYSGSRSGSWVKTKCIRRQEFVIVGWTPSDKQRGFRSLLLGVNEDGKLRYAGKVGTGFT
GDEIERLLEIMAPLARKEPTVQAPRSAVRGAHWIEAKLVAEIAYLEFTDEGLLRHPSYLG
LREDKKPEAVVIEKEAPVAVATAAPASTVKVSNRDRVIFPEGKLTKGQLADYYEVVAPIM
LPWAGSRPISLVRCPQGRAKKCFFQKHDAGSFGDDVKHIGIREKDGHEEAYLFIDAPAGL
LTCVQMGTIEFHGWGARIEDVEKADRLVFDLDPDEGLGFKEVVSAAFNMRDLLGEMGLTT
FPMVTGGKGVHVIAPLTPSAEWRVVKDFAHRFAQAVEQAQPDRYTAALSKSRRTGRIFID
YLRNQRGATAVMPYSARSREFAPIAVPLTWDELHDLDKPSHWHIGDGAEMLKRASSKNLA
HWGRADQLLPDL
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagcatgccgcgacccgcctgcattatgacttccgcctcgagctggacggcacg
ctggtcagctgggcagtgacccgagggccaagcgccaaccccgacgacaagcgattggct
gtccgcaccgaagaccacccgctcgactatgcccggttcgaggggaccattcccaagggg
gagtatggcggcggcaccgtgatgctttgggacaacggcacctgggatccagtcccgggc
aaggatcccaccaaaaccctggccgaaggtcatctgcattttacgctgcatggccgccgc
atgaagggcgagtggatcatgtttcgcctcaagccgcgaggaaaggagaagggcgaaaac
tggatcctgcgtaaggtcgaggacgagtttgccggtggctcggacgacctcattggcatc
catctcacgagcgtcgacagcggacgcaccatggaagaaatcgccgcaggcgagccgatc
cggagacagggcggcaaggctaaagctccggctacgacgccgaaatcatcgaccgctgca
gcccgaaagggcaagaacaagggcaaactcccgccattccagcctgtccagcttgcggct
ctcgtcgatcacgtgccacctggcgatcgctggctgcatgagttgaaatatgacggctat
cgaacgctcatcgccgtcggtggcggggaaggacgggcctatacccggtcgggtctggac
tggtcggatcggttcgcagatattatcacagaggctgcacagcttgacgttggaagcgcg
ctgatcgacggtgaggcggtggtgacgctgcctgatggccggaccagttttcaggcgttg
caagccgctctgaaggataaccctgggaccatcgactatttcgcgttcgacctgctggaa
ttgaacggcgaggatctcaccagcttgccgctgatcgagcgtaaggagaagctggcgagc
attcttgagggccacaagggtcggctgcgctattcagatcatatcgtcggcaacggtgaa
aagctgctgaccagcttttgcgaggcggggctggaaggggtcatatcgaaacgcgtcgac
gctcgatatagcggctcgcggagcggtagctgggtcaagaccaagtgcatccgtcggcag
gagttcgtgattgtaggctggacgccttccgacaagcagcgagggttccgctcgcttctt
ttgggcgtaaacgaggatggaaagctgcgctacgccggcaaggtcggcacgggatttacc
ggcgatgagatagagcgtcttctagaaatcatggcacctctcgcgcgcaaggagccgacg
gttcaggctccgcggtctgctgtgcgcggtgcccactggatcgaagcgaaactggttgcc
gagattgcctacctagagtttaccgatgaggggctgctgcgccatcccagctaccttggg
cttcgagaggacaagaaacccgaagcggtcgtgatcgagaaggaggccccggtggcggtt
gcaacggcggcgcccgcgagcacggtgaaggtgagcaaccgagaccgggtgatctttccg
gagggcaagctcaccaagggtcagctggcagactattacgaagtggtcgcaccgatcatg
ctgccctgggcggggagcaggcccatcagtctcgtgcgttgcccgcaaggccgcgcgaag
aagtgtttctttcagaagcatgatgcgggcagcttcggcgatgacgtcaagcacatcggc
attcgcgaaaaggacgggcatgaagaggcctatctctttatcgacgcgccggcaggtctg
ctgacctgtgtgcagatgggtacgatcgagttccatggctggggcgcgcggatcgaggac
gtcgaaaaagccgacaggctggttttcgatctcgaccccgatgagggccttggcttcaag
gaagtggtctcggctgccttcaacatgcgggacttgctgggtgagatgggacttacgacg
ttcccgatggtgacgggcggaaaaggggttcacgtgatcgccccgctcaccccgtcagcc
gaatggcgggtggtgaaggattttgcccatcggttcgcgcaagccgtggagcaagcgcag
ccggatcgctacaccgccgctttgtcaaaatcccggcggaccggccgcattttcatagac
tacctgcgcaaccagcgcggcgcgacggctgtcatgccctatagcgcccgcagtcgtgag
tttgcgccgatcgccgttcctctgacatgggacgaactgcatgatctcgacaagccttcg
cactggcacatcggagacggagccgaaatgctgaagcgcgcgtcgtcaaagaacctcgcg
cactggggacgggccgaccaactgttgcccgatttgtaa

DBGET integrated database retrieval system