KEGG   Sphingobium sp. YG1: YGS_C1P1811Help
Entry
YGS_C1P1811       CDS       T05858                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spyg  Sphingobium sp. YG1
Brite
KEGG Orthology (KO) [BR:spyg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YGS_C1P1811
Enzymes [BR:spyg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     YGS_C1P1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like AlaDh_PNT_C NAD_binding_7 FAD_binding_2 FAD_oxidored DAO Glutaredoxin FAD_binding_3 FMO-like K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: BBD00556
UniProt: A0A2Z6AF74
LinkDB All DBs
Position
1:1933281..1934876
Genome map
AA seq 531 aa AA seqDB search
METHKMLDANLKGQLKAYMANITQPIELVASLDDGAKSREMGELLNEIAELSDKVSVVTG
ADKRKPSFMIRRVGTDIGVTFAGLPMGHEFTSLVLALLQVGGHPSKAAQDLIQQVKDLDG
DFAFETYFSLSCQNCPDVVQALNLMSVLNPRISHVAIDGGLFKEEVDVRKVMAVPTIFLN
GEPFGQGRMELEQIVAKIDSGAEAKAAEKIKAQDPFEMLVIGGGPAGAASAIYAARKGIR
TGVAAERFGGQVLDTMDIENFISVSRTEGPKLASALEAHVKDYDVEIMNLQKAAKLIPSK
VEGGYHEVVLENGASLKGRTLILSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKGKR
VAVIGGGNSGVEAAIDLAGIVAHVTLVEYDSQLRADAVLQRKLASLPNVKIITSALTTKV
DGNGERVTGLSYKDRNHGTEHDVELEGIFVQIGLVPNTEWLKDAIALSPRGEIEIDARGE
TSQPGIFAAGDCTTVPYKQIVIAMGAGSTAALSAFDYLIRLPASEDAAQAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcacaagatgttggacgcaaatctcaagggtcaattgaaggcctatatggcg
aacatcacgcagcccatcgagctggtggcgtcgctggatgatggcgcgaagtcgcgcgaa
atgggcgaactgctgaacgaaatcgccgaactgtcggacaaggtgtcggtcgtgacgggc
gcggacaagcgcaagcccagcttcatgatccgccgcgtgggcaccgatatcggcgtgacc
ttcgcaggcctgccgatggggcatgaattcacctcgctggtgctggcgctcctccaggtc
ggcggtcatccgtcgaaggccgcgcaggatctgatccagcaggtcaaggatctggacggg
gacttcgccttcgaaacctatttctcgctgtcgtgccagaactgcccggacgtggtgcag
gcgctcaacctgatgagcgtcctcaatccccggatcagccatgtcgccatcgacggcggc
ctgttcaaggaagaggtggatgtgcgcaaggtgatggcggtaccgaccatcttcctgaac
ggcgaacccttcgggcagggccgcatggaactggagcagatcgtcgccaagatcgacagc
ggcgcggaagcgaaggcggccgagaagatcaaggcgcaggatccgttcgaaatgctggtg
atcggcggcggccccgccggcgcggcatcggccatctatgcggcacgcaagggcatccgc
accggcgtcgcggccgaacgcttcggcggtcaggtgctcgacacgatggatatcgagaat
ttcatctcggtttcccgcacagagggaccgaagctcgcgtcggcgctggaagcgcacgtc
aaggattatgacgtcgagatcatgaacctgcaaaaggcggcgaagctgatcccttccaag
gtcgagggtggctatcatgaagtcgtgctggaaaatggcgcatcgctgaagggccgcacc
ctcatcctgtccaccggcgcccgctggcggcagatgggcgtgccgggcgaagaggagtat
cgcaacaagggcgtcgcctattgcccccattgcgacggtccgctgttcaagggcaagcgc
gtggcggtgatcggcggcggcaatagcggcgtcgaggcggccatcgatctggccggtatc
gtcgcgcatgtgacgctggtcgaatatgacagccagctgcgcgccgatgcggtgttgcag
cggaaactggccagcctgccgaacgtgaagatcatcacatcggcgctaaccaccaaggtc
gacggcaatggcgagcgggtgacgggcctgtcctacaaggaccgcaaccatggcacggaa
catgatgtcgaactggaaggcattttcgtccagatcggcctggtccccaacaccgaatgg
ctgaaggacgcgatcgctttgtcgccgcgcggcgagatcgagatcgacgcgcgtggcgaa
accagccagccgggcatcttcgccgcaggcgactgcacgaccgtgccctataagcagatc
gtgatcgcgatgggcgcgggatcgacggcggccttgtcggccttcgactatctcatccgc
ctgccggccagcgaagacgcggcgcaggcggcgtaa

DBGET integrated database retrieval system