KEGG   Sphingobium sp. YG1: YGS_C1P1972Help
Entry
YGS_C1P1972       CDS       T05858                                 

Definition
(GenBank) membrane fusion protein, multidrug efflux system
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
spyg  Sphingobium sp. YG1
Brite
KEGG Orthology (KO) [BR:spyg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spyg02000]
    YGS_C1P1972
Transporters [BR:spyg02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   YGS_C1P1972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_3 HlyD_D23 HlyD Biotin_lipoyl_2 Biotin_lipoyl OEP DUF641 HlyD_2
Motif
Other DBs
NCBI-ProteinID: BBD00717
UniProt: A0A2Z6AFM1
LinkDB All DBs
Position
1:complement(2116180..2117343)
Genome map
AA seq 387 aa AA seqDB search
MADATPETPAPDNGAPDNDAQQDARQSARKTWLIRLGLIVVVGGVLWAGWYLLVGRNHVA
TDNAYVNAEMAQVTPLLSAQATEVLVSDTQAVKRGDILVKLDPTDAKIAVAQAQADLAEA
KRKFRQTSATSTSLAAQVDARGADIVQARAQLTSAQADFDKARIDLQRREALVGDGAVSG
DEVTSARKAYVSARAALELARAGVQTAQATRGAASGQLAANDALVRGSTIDTDPAVMAAQ
AKLDTAKLNLDRSVIRAPIDGVISKRQVQVGQRVAQGSPIMSIVPLTQVYVDANFKERQL
RDVKVGMPATVTSDLYGSNVVYHGKVVGFSGGTGASMSLIPAQNATGNWIKVVQRLPLRI
ALDPKELAAHPLRVGLSMDVEIDLSDK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgccacgcccgaaaccccagcaccggacaatggcgcgccggacaatgatgcg
cagcaggatgcccgccagtcggcgcgcaagacatggctgatccggctgggcctgatcgtc
gtcgtgggcggcgtgttgtgggccggctggtatctgctggtcggacgcaatcatgtcgcg
accgacaatgcctatgtgaacgccgaaatggcgcaggtcacgccgctgttgtcggcgcag
gcgaccgaggttctggtcagcgatacgcaggccgtgaagcgcggcgacatattggtgaag
ctggacccgaccgacgcgaagatcgcggtggcgcaggcgcaagcggatctggccgaagcc
aagcgcaagttccgccagaccagcgcgaccagcacatcgctggcggcgcaggtggatgcg
cgtggcgcggacatcgtgcaggcgcgcgcgcagctgacgagcgcgcaggccgatttcgac
aaggcgcggatcgacctgcaacggcgcgaggcgctggtgggtgacggcgcggtgtcgggc
gacgaagtgaccagcgcgcgcaaggcctatgtatccgcccgcgcggcactggagctggcg
cgtgccggggtgcagacggcgcaggcgacgcgtggcgcggcgagcggccagctggcggcc
aacgacgcgctggtgcgtggatcgacgatcgacacggacccggcggtgatggcggcgcag
gccaagctggatacggcgaagctgaacctcgatcgctccgtcatccgcgcgccgatcgac
ggcgtcatcagcaagcggcaggtgcaggtcggccagcgcgtggcgcagggcagcccgatc
atgagcatcgtgccgctgacccaggtctatgtcgatgcgaacttcaaggaacgccagttg
cgcgacgtgaaggtcggcatgcccgccacggtgacgtccgacctttatggcagcaacgtc
gtctatcatggcaaggtcgtcggtttttcgggcggcacgggtgcgtccatgtcgctgatc
ccggcgcagaatgcgaccggcaactggatcaaggtggtgcagcgcctgccgctgcgcatc
gcgctcgaccccaaggaactggcggcgcatccgttgcgcgtgggcctgtccatggatgtc
gagatcgacctttccgacaaataa

DBGET integrated database retrieval system