KEGG   Sphingobium sp. YG1: YGS_C1P2944Help
Entry
YGS_C1P2944       CDS       T05858                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spyg  Sphingobium sp. YG1
Pathway
spyg00473  D-Alanine metabolism
spyg00550  Peptidoglycan biosynthesis
spyg01100  Metabolic pathways
spyg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spyg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    YGS_C1P2944
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YGS_C1P2944
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    YGS_C1P2944
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spyg01011]
    YGS_C1P2944
Enzymes [BR:spyg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     YGS_C1P2944
Peptidoglycan biosynthesis and degradation proteins [BR:spyg01011]
 Precursor biosynthesis
  Amino acid ligase
   YGS_C1P2944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C
Motif
Other DBs
NCBI-ProteinID: BBD01689
UniProt: A0A2Z6AIA6
LinkDB All DBs
Position
1:3143652..3144683
Genome map
AA seq 343 aa AA seqDB search
MIATHPRQIRIPAADKARLRLLFLAKHACADGRPDAQDGNHAIYHHEMRTTLEAIGLNVD
VANSYDALYQRPDTDFVVTLLNRGGFQNSEMLAPLLLNRRDMPYLGASPIVRGLSDDKYL
SKMIARARGVPTMAAQLFRRGGLFEAPAFEADRLVVKPNASSASWGVNMVDTWAQARDHA
DSLFALGHDVLVEQWAPLLDVAVPVVGGSGGQPWILPPMMYVPADPHRERSYEEKRGLID
AGDDPLILVEDADLRSRLEAMTAALLPELWPFDYGRFEFRYDPASGQLLFMEVNLSCNLW
SKKTISRSAASIGVDHAALVETIVGHSLARQGLLDEAIVQVAA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgacacatccccgccagatccgcatccccgccgccgacaaggcgcggctgcgc
cttctcttccttgccaagcacgcctgtgccgacggccggccggacgcgcaggatggcaat
cacgccatctatcatcatgaaatgcgcacgacgctggaggcgatcggcctcaacgtcgat
gtcgcgaacagctatgacgcgctctatcagcggcccgatacggacttcgtcgtcaccctg
ctcaaccggggcggtttccagaatagcgagatgctggcgccgttgctgctcaatcggcgc
gacatgccttatctcggcgccagcccgatcgtgcgtggcctgtccgacgacaaatatctc
agcaagatgatcgcgcgcgcgcgcggcgtgccgaccatggcggcgcagcttttccgtcgc
ggcggcctgttcgaggcacccgcgttcgaggcggatcggctggtggtgaagcccaacgct
tcctccgcctcctggggcgtgaatatggtcgatacatgggcgcaggcgcgcgatcatgcc
gacagcctgttcgcgctgggccatgatgtgctggtggaacaatgggcgccgctgctggac
gtcgcggtgccggtggtcggcggcagcggtggccagccctggatcctgccgccgatgatg
tatgtgccggccgacccgcatcgcgagcgcagctatgaggagaagcgcgggctgatcgac
gcgggcgacgatccgctgatcctggtcgaggatgccgacctgcgcagccggctggaggcg
atgaccgccgcgctgctgcccgaactctggccgttcgactatggccggttcgaattccgc
tatgatccggcgagcgggcaattgctgttcatggaagtgaacctgtcctgcaatctctgg
tcgaagaagacgatctcgcgctccgccgcctcgatcggcgtcgatcatgccgctttggtc
gaaaccatcgtcgggcatagcctggcgcggcagggcctgctggacgaagcgatcgtgcag
gtggcggcatga

DBGET integrated database retrieval system