KEGG   Sphingobium sp. YG1: YGS_C1P2968Help
Entry
YGS_C1P2968       CDS       T05858                                 

Definition
(GenBank) L-idonate 5-dehydrogenase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
spyg  Sphingobium sp. YG1
Brite
KEGG Orthology (KO) [BR:spyg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    YGS_C1P2968
Enzymes [BR:spyg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     YGS_C1P2968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: BBD01713
UniProt: A0A2Z6AI97
LinkDB All DBs
Position
1:complement(3171158..3172213)
Genome map
AA seq 351 aa AA seqDB search
MLAAICHGKKDLRVESRVEPALAADEVRVGVAYGGICGSDMHYYHRGAVGDFAVRESMAL
GHEISGVVLEVGSAVTHVEPGMKAALDPSRPCLTCDYCRAGRMNLCTDMVFLGSAGRFPH
VQGGFAQTLILRGDQIIPVPADADLLALSVAEPLSIGLHAVNRAGPLMGKRVIVTGSGPI
GLLTARCAIHAGAIEVVCTDVEDAALAVARDRMGATRTINVATDPDALATYASPAGHFDV
AFEASGAPSALLSLFPIVRRGGRIVQVGMLPPGTAPIPVNPLQSREIEFVGAFRANGEFR
LAVDLIVSGAIDVSPILSGTFPLERSVDAFEQAGDRSRFVKLHIAINEDIL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgctggctgcgatatgtcatgggaagaaggatttgcgggtggaatcccgtgtcgagccg
gcgctggccgccgatgaggtccgggtcggcgtcgcctatggcggcatttgcgggtcggac
atgcactattatcatcgcggcgccgtgggcgacttcgcggtgcgcgaatcgatggcgctg
ggccatgaaatttccggcgtcgtgctggaggtcggatcggccgtcacccatgtcgaaccg
ggcatgaaggcggcgctggaccccagccgcccctgcctcacctgcgactattgccgcgca
ggccgcatgaacctctgcaccgacatggtcttcctgggcagcgccggccgcttcccccat
gttcagggcggctttgcgcagacgctgattctgcgcggggatcagatcatcccggttccg
gccgatgccgacctgctcgccctgtcggtcgccgaaccgctgtcgattggcctccatgcc
gtcaaccgcgccggcccgctgatgggcaagcgcgtcatcgtcaccggctccggcccgatc
ggcctgctgactgcgcgctgcgcgatccatgccggcgcgatcgaagtggtctgcaccgat
gtcgaggatgctgcactcgccgtcgcgcgcgatcgcatgggcgccacccgcaccatcaac
gtcgcgaccgatcccgacgcgctggccacctatgccagccccgccggtcatttcgacgtc
gcgttcgaagcatcaggcgcgccatccgccctgctctcgctcttccccatcgttcggcgc
ggcggccgcatcgtgcaggtcggcatgctgccccccggcaccgcccccatcccggtcaac
ccgctgcaatcgcgcgagatcgagttcgtcggcgccttccgcgccaatggcgagtttcgc
ctggccgtcgacctgatcgtcagcggcgcgatcgacgtgtcgccgatcctgtcgggcacc
ttcccgctcgaacggtcggtcgatgccttcgaacaggccggcgaccgctcgcgcttcgtc
aaactgcacatcgccatcaacgaggatatcctgtga

DBGET integrated database retrieval system