KEGG   Sphingobium sp. YG1: YGS_C2P0752Help
Entry
YGS_C2P0752       CDS       T05858                                 

Definition
(GenBank) enoyl-[acyl-carrier protein] reductase I
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
spyg  Sphingobium sp. YG1
Pathway
spyg00061  Fatty acid biosynthesis
spyg00780  Biotin metabolism
spyg01100  Metabolic pathways
spyg01130  Biosynthesis of antibiotics
spyg01212  Fatty acid metabolism
Module
spyg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:spyg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YGS_C2P0752
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YGS_C2P0752
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    YGS_C2P0752
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spyg01004]
    YGS_C2P0752
Enzymes [BR:spyg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     YGS_C2P0752
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     YGS_C2P0752
Lipid biosynthesis proteins [BR:spyg01004]
 Fatty acid synthase
  Component type
   YGS_C2P0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: BBD02738
UniProt: A0A2Z6AKZ6
LinkDB All DBs
Position
2:complement(915793..916566)
Genome map
AA seq 257 aa AA seqDB search
MTPLVDLTGKRGLVIGIANEHSIAAGCAEAFARCGARLAATYLNEKAKDWVQPVVDQLGV
EWTAPCDVRIPGELEALFGQVQERWGGLDFLLHSIAFAPKEDLHGRVVDSSAQGFSTAMD
VSCHSFLRMAKLAEPLMATGGCLLCVTFYGSERVVEHYNLMGPVKAALESATRYVAAELG
AKAIRAHAISPGPIATRAASGIDRFDELLDRAAAQVPAGKLVDVSDVGALAAFLVSDAAK
RITGTIIPVDNGQHLFA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgcttgtagatctgaccggcaagcgcggcctcgtcatcgggatcgcaaacgaa
catagcatcgcggcaggatgcgcggaggcatttgcccggtgcggcgcccggcttgccgcc
acctatctcaacgaaaaggcaaaggactgggtccagcctgtcgtcgaccagctcggcgtc
gaatggactgcgccgtgcgatgtacgcatccccggcgaactcgaggcgcttttcggccag
gtgcaagaacgctggggtggcctcgatttcctgctgcactcgatcgccttcgcgccgaag
gaggatctccacggtcgggtggtcgacagcagtgcgcaaggcttctcgacggcgatggac
gtgtcctgccacagtttccttcgcatggcgaagctcgccgaaccgctgatggcaacgggc
ggatgcctgctttgcgtgaccttctatggttcggagcgggtggtcgaacactataacctg
atgggtcccgtcaaggcggccctggaaagcgcaacgcgctatgtcgccgcggaactgggc
gccaaagccattcgggcacacgctatttcaccagggccgattgccacccgcgccgcaagc
ggaatcgaccggttcgacgagttgctcgatcgggctgccgcgcaggttcccgcaggaaaa
ttggttgacgtaagcgacgtcggcgcgctggccgccttcctcgtcagcgatgccgcgaag
cggatcaccggcacgatcattccggtcgataacgggcagcatcttttcgcgtga

DBGET integrated database retrieval system