KEGG   Streptococcus pyogenes HSC5 (serotype M14): L897_01385Help
Entry
L897_01385        CDS       T02743                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
spyh  Streptococcus pyogenes HSC5 (serotype M14)
Brite
Enzymes [BR:spyh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     L897_01385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 Beta-lactamase2 RNase_HII Beta-lactamase EVI2A Peptidase_S13 HTH_56 DUF3693 DUF4375
Motif
Other DBs
NCBI-ProteinID: AGQ27139
LinkDB All DBs
Position
complement(249381..250562)
Genome map
AA seq 393 aa AA seqDB search
MTKRIILTIFTFICFSMMPLVHAEDVMDITRQAGYTVSEVNRPKSSIVVDANSSDILWQD
NIDIPRDPASMSKMFTLYILFEELAKGKITMDTTITATPTDQAIANIYEISNNNIVAGVA
YPIRDLITMTAVPSSNAATVMIANYLSNNDASAFIDRINATAKQLGMTNTHFSNASGAAA
QAFQGYYNPTKYDLSASNITTARDLSKLLYAFLKKYPEIISFTNKSVVHTMVGTPYEEEF
HTYNHSLPDNQFGMKGVDGLKTGSSPSAAFNAMITAKRGKTRLITIVMGVGDWSDQNGEF
YRHPFVNALTEKGFKDSKTLSKKARQKLEKLVPQTKKETSPKQQHFKATKKQSYLERVED
FMNHNHTFLLICLAIFIITILLLSLVVFAMGRQ
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaaaagaattatactaactatttttacctttatttgcttttcgatgatgcctctt
gtccacgccgaagatgtcatggatattacaaggcaagcaggctacacagttagtgaggtt
aatcgaccaaaatcttctattgtcgttgatgcaaatagttcagatattctttggcaagat
aatattgatattcctagggatcctgctagtatgtctaagatgtttacgctttacatttta
tttgaagagctcgctaagggaaaaattacgatggacactactattacggcaactccaacc
gatcaagctatcgctaacatttatgagattagcaataataatatcgtcgctggagtagct
tatcctattcgtgatcttattactatgacagctgtgccttcatcaaatgcagcaactgtt
atgattgccaattatttatcaaacaatgatgcttctgcgtttatcgatcgtattaatgcc
acagccaaacaattaggcatgactaacactcatttttcaaacgctagtggtgcagcagca
caagcttttcaaggttattataatcctactaaatatgatttatctgcttcaaatattacg
accgctcgagatttgtccaagttactctatgccttcttaaaaaaataccctgaaattatc
tcctttacaaataaatctgttgtgcacactatggtaggaacgccatatgaagaagaattt
cacacctataaccactctctcccagataatcaatttggtatgaaaggagttgatggatta
aaaacaggttctagtcccagcgctgcttttaacgccatgataactgccaaaagaggcaaa
actcgactcattactattgtcatgggggtcggagattggtcagatcaaaacggagagttt
tatagacatcctttcgttaatgccttgactgagaaagggtttaaagatagtaagacctta
tccaaaaaagcacgccaaaaactcgaaaaattagtgccacaaaccaaaaaagaaacatca
cctaaacagcagcacttcaaagccactaaaaagcaatcgtacttggaaagagtcgaagat
tttatgaatcacaaccatactttcttgcttatttgcttagctatctttataattactatc
cttttactaagcctcgttgtctttgcaatgggacgccaataa

DBGET integrated database retrieval system