KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_1413Help
Entry
M1GAS476_1413     CDS       T02499                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Brite
KEGG Orthology (KO) [BR:spym00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spym01001]
    M1GAS476_1413
Enzymes [BR:spym01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     M1GAS476_1413
Protein kinases [BR:spym01001]
 Serine/threonine kinases: Other
  Bacterial family
   M1GAS476_1413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Kinase-like Haspin_kinase FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: BAM30731
UniProt: J7M1T9
LinkDB All DBs
Position
1:complement(1319435..1321333)
Genome map
AA seq 632 aa AA seqDB search
MIQIGKLFAGRYRILKSIGRGGMADVYLANDLILDNEDVAIKVLRTNYQTDQVAVARFQR
EARAMAELNHPNIVAIRDIGEEDGQQFLVMEYVDGADLKRYIQNHAPLSNNEVVRIMEEV
LSAMTLAHQKGIVHRDLKPQNILLTKEGVVKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATIQSDIYAMGIMLFEMLTGHIPYDGDSAVTIALQHFQKPLPSIIEENHNVP
QALENVVIRATAKKLSDRYGSTFEMSRDLMTALSYNRSRERKIIFENVESTKPLPKVASG
PTASVKLSPPTPTVLTQESRLDQTNQTDALQPPTKKKKSGRFLGTLFKILFSFFIVGVAL
FTYLILTKPTSVKVPNVAGTSLKVAKQELYDVGLKVGKIRQIESDTVAEGNVVRTDPKAG
TAKRQGSSITLYVSIGNKGFDMENYKGLDYQEAMNSLIETYGVPKSKIKIERIVTNEYPE
NTVISQSPSAGDKFNPNGKSKITLSVAVSDTITMPMVTEYSYADAVNTLTALGIDASRIK
AYVPSSSSATGFVPIHSPSSKAIVSGQSPYYGTSLSLSDKGEISLYLYPEETHSSSSSSS
STSSSNSSSINDSTAPGSNTELSPSETTSQTP
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgattcagattggcaaattatttgctggtcgttatcgcattctgaaatctattggccgc
ggtggtatggcggatgtttatttagcaaatgacttgatcttggataatgaagacgttgca
atcaaggtcttgcgtaccaattatcaaacagatcaggtagcagttgcgcgtttccaacga
gaagcgcgggccatggctgaattgaaccatcccaatattgttgccatccgggatataggt
gaagaagacggacagcaatttttagtaatggaatatgtggatggtgctgacctaaagaga
tacattcaaaatcatgctccattatctaataatgaagtggttagaattatggaagaagtc
ctttctgctatgactttagcccaccaaaaaggaattgtacacagagatttaaaacctcaa
aatatcctactaactaaggagggtgttgtcaaagtaactgatttcggcatcgcagtagcc
tttgcagaaacaagcttgacacaaactaattcgatgttaggcagtgttcattacttgtct
ccagaacaggctcgcggctccaaagcgacgattcaaagtgatatttatgcgatggggatt
atgctctttgagatgttgacaggccatatcccttatgacggcgatagtgctgttacgatt
gccttgcaacattttcaaaagcctcttccatctattatcgaggagaaccacaatgtgcca
caagctttggagaatgttgttattcgagcaacagccaagaaattaagtgatcgttacggg
tcaacctttgaaatgagtcgtgacttaatgacggcgcttagttataatcgtagtcgggag
cgtaagattatctttgagaatgttgaaagtaccaaacccctccccaaagtggcctcaggt
cccaccgcttctgtaaaattgtctccccctaccccaacagtgttaacacaggaaagtcga
ttagatcaaactaatcaaacagatgctttacagccccccaccaaaaagaaaaaaagtggt
cgttttttaggtactttattcaaaattcttttttctttctttattgtaggtgtagcactc
tttacttatcttatactaactaaaccaacttctgtgaaagttcctaatgtagcaggcact
agtcttaaagttgccaaacaagaactgtatgatgttgggctaaaagtgggtaaaatcagg
caaattgagagtgatacggttgctgagggaaatgtagttagaacagatcctaaagcagga
acagctaagaggcaaggctcaagcattacgctttatgtgtcaattggaaacaaaggtttt
gacatggaaaactacaaaggactagattatcaagaagctatgaatagtttgatagaaact
tatggtgttccaaaatcaaaaatcaaaattgagcgcattgtaactaatgaatatcctgaa
aatacagtcatcagtcaatcgccaagtgcgggtgataaatttaatccaaacggaaagtct
aaaattacgctcagtgttgctgttagtgatacgatcactatgcctatggtaacagaatat
agttatgcagatgcagtcaataccttaacagctttaggtatagatgcatctagaataaaa
gcttatgtgccaagctctagctcagcaacgggctttgtgccaattcattctcctagttct
aaagctattgtcagtggtcaatctccttactatggaacgtctttgagtttgtctgataaa
ggagagattagtctttacctttatccagaagaaacacactcttctagtagctcatcgagt
tcaacgtcaagttcaaacagttcttcaataaatgatagtactgcaccaggtagcaacact
gaattaagcccatcagaaactacttctcaaacaccttaa

DBGET integrated database retrieval system